KEGG   Felis catus (domestic cat): 101083124Help
Entry
101083124         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensin-converting enzyme-like protein Ace3
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04614  Renin-angiotensin system
fca04924  Renin secretion
fca05142  Chagas disease (American trypanosomiasis)
fca05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    101083124
   04614 Renin-angiotensin system
    101083124
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    101083124
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    101083124
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101083124
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M2
   101083124
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101083124
CD molecules [BR:fca04090]
 Proteins
  101083124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 DUF1138 Mtc
Motif
Other DBs
NCBI-GeneID: 101083124
NCBI-ProteinID: XP_023099791
LinkDB All DBs
Position
E1
AA seq 757 aa AA seqDB search
MGTRWTCHGPSLFVLFCYGQLLPWLRTEGDQNLDKFYNETMAKMFLQFYEHTAQVVWNQF
MEATWNYVTNITKKNREEMLHKDSERSQHMPYFGTWARLFKISRFQDPDMKRMLSKLQNI
DKAALPQDDAAQYNMLLAYMETTYSMAQVCLNEGPCLPLEPDLEEVMATSRDEKELLWAW
QGWQDAVGHQLCITFKCYVQLSNRTAKLNGYKDMGALWRSXESDTLEHDLEQLYQELQPL
YLNLHTYMCRALHRHYGSELINLRGSIPAHLLRNMWAQFWVNILDLVLPFPKKPLEDITK
IMKSQHWKPSKMFEGAEKFFTSLGLLSTPPNFWKTSMMEKPTDGREVECHASAWDFYDGK
DVRVKKCTEVTIEDLLSIFHQMGHIQYFLQYKNLSVIFCAGANPAFEEAVGSMVTLSASS
HKYLLNRGLLSHQHQDSEEEVNFLMGIALEKIAFIPFAYLMDLFRWKVFDGTIQKDVYNQ
EWWNLRTQLHGTSPLSWCPPPPVPQTEDYFDPGAKFHISASVPYIRYFISLVLQFQFHDA
LASGHVGPLHRCDSYNSKIAEKLLEDVLKLGSSKPWPEVLQKITGQTKVSAKALMTYFKP
LLDWLVTENVRQGEILGWPDFSCTFEEKDTDKVTFLSLELDADQAKFGQWVLLALSFVMF
LVXLLLACRLYSLEKRPLSQNTKAQNTGSQDSSALKTQPRAYFLGIAMEPCLVAKRQWIL
LGLCLILTLRSISLIIQILTQHNRKPLWMRAEWWSWD
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgggtacaagatggacttgtcatggaccttccctatttgtgctcttctgttatgggcag
ctcttgccatggctcaggaccgagggtgatcagaacttagacaagttctacaatgagacc
atggcaaagatgttcctgcagttttatgagcataccgcccaggttgtatggaaccagttc
atggaggccacctggaactatgtcaccaacatcaccaagaaaaaccgggaggagatgctg
cacaaagactcagagaggtcccagcacatgccgtactttggcacttgggcccgcctgttt
aagatctccaggttccaggacccggacatgaagcgcatgctgagtaagctgcagaacata
gacaaggcagccctgccccaggacgatgccgcccagtacaacatgcttctggcctacatg
gagacgacatacagcatggcccaggtgtgcctgaatgagggaccctgcctacccctggag
cctgaccttgaagaagtcatggccacctcccgggatgagaaggagctgctgtgggcctgg
caaggctggcaggatgctgtgggtcatcagctctgcatcaccttcaagtgctatgtgcag
ctcagcaacaggactgcaaagctcaacggttacaaagacatgggggccttgtggcggtcc
naagagtctgacaccctggaacacgacctggagcagctttaccaggagctgcagccactc
tacctaaacctgcacacctacatgtgccgggccctgcaccgccactacgggtcagagctt
atcaacctgcggggatccatccctgcccacctcctgaggaacatgtgggctcagttctgg
gtcaacatcttagacctggtcctgcccttcccaaagaagcctcttgaggacatcacaaaa
atcatgaaaagccagcactggaagccctcaaaaatgttcgaaggggctgaaaaattcttc
acctccctggggctgctttccacccctcccaacttctggaaaacttcaatgatggaaaag
ccaaccgatgggcgagaggtggagtgccacgcctctgcctgggacttctacgacggcaag
gacgtcagggtaaagaagtgcaccgaggtgaccatagaagacctgctctccatcttccac
cagatgggccatatccagtacttcttgcagtacaagaacctctctgtgatcttctgtgca
ggagccaacccagcctttgaagaggccgtggggtcgatggttaccctctcggcctcctcc
cacaaatacctgctcaacagaggcctgctcagccaccagcaccaggactcagaggaggag
gtcaatttcctgatgggcatcgccctggagaagatcgcctttatccccttcgcctacctg
atggacctgtttcgctggaaggtctttgatggcaccatccagaaggacgtctacaaccag
gagtggtggaacttgagaacccaactgcatggtaccagtcccctgtcctggtgccccccc
ccccccgtccctcagacagaggattactttgatcctggtgccaagttccacatttctgcc
agcgtgccctacatacggtacttcatcagcctagtactccagttccagttccacgatgct
ctggcctcaggccatgtgggcccattgcaccgatgtgacagctataactccaagatagct
gagaagctcctggaggatgtcctaaagctgggctcaagcaagccttggccagaagtcctg
cagaagataaccgggcagaccaaagtgtctgcaaaggccctcatgacttacttcaagccc
ctcttggactggctggtcactgagaatgtgcggcagggggagatcctgggctggccagac
ttcagctgtacctttgaagaaaaagacacagacaaggtgacatttctgagtctggagctg
gacgctgaccaggccaaatttgggcagtgggtgctgctggccctcagctttgtcatgttc
ctggtgngcctactgctggcctgcaggctgtactccctggaaaaaaggccattgtcccag
aacaccaaggcacagaacaccggttcacaggactccagtgcactcaagacacagcccagg
gcctacttcctggggatagccatggagccctgcctggttgccaaaagacagtggatcctg
ctgggcctctgcctcatcctgacgctgcgctcaatcagcctgatcattcaaattctcaca
cagcacaacagaaagcctctgtggatgagagctgaatggtggagctgggactag

DBGET integrated database retrieval system