KEGG   Folsomia candida: 110845544Help
Entry
110845544         CDS       T05043                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
fcd  Folsomia candida
Brite
Enzymes [BR:fcd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     110845544
Peptidases [BR:fcd01002]
 Metallo Peptidases
  Family M2
   110845544
Exosome [BR:fcd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110845544
CD molecules [BR:fcd04090]
 Proteins
  110845544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1253 aa AA seqDB search
MGVAKTLYLLTALLATLWHPTACTTPKLAGKATDDEARQYLEEVLESRYSGACNTQITTR
WAYITNVTTETAEASTAADTAFLEFQASIQAEILANFSNWREFNDSQVRREFQYLSIKGP
ARMPPTDVSNMNKLQSSMETAYATAAVCDFRNSSKCDLRLDPEIEEKLRTATDWDELAYY
WTEWHNAMSNAVRPANYTLFIRWQNEMARANGFNDMSQMWLTGYDDESPDFDAVIFKRQM
LDIWEELRPYYNILHAYVRMKLRRLPEYQDRITKYGYLPAHILGNMWGQDWAHLDNKTKP
FPNAPSLDATDAMIRANYTTLKMFQESDKFFTDLGLLPMTPAFWNNSMLERPSDGREVVC
HASAEDMCLGKGSTDFRIKQCTKVTMDDLVTVHHEMGHIEYFLQYTDEHYIFRDGANPGF
HEAIGDALALAVVTPKHLQCVLNLDLGLDIDCSNTTVYQADTVTETDYNFLFITALQKFV
FFPFAISMDSWRWEVFEGKMSEYNYNTRWWELRQKNQGIEPPFPRNASDFDATAKYHIVA
NVPYIRYFVSHILQFQFYEAMCKAAGEFDPDNNSSKPLYQCDFSGSRDAGTLLGNMMKLG
FTRGWPTALEAITGSRNMSIAPLLNYFKPIFDLMQKDLVDNGEEPCFGPSCEEVAKKYLS
EKLEKEASALHTKSAHAEWAYSTNLTNDEAKKEVEKVNLEYSSYEKKEWKEYISQFKYET
FNDSAIRRQFKFLNDIGISALNESDVVEFNTVSSEMKKIYGTGKICPFSMQECNITTNGL
SLNPDLEEILAKVKDYDEMAYVWKSWRDATGAKIRPLYYKYIDLQNKAAKANGYDNAGEY
WIRKYESPDFRKDLEELWQDVKPLYAELHAYVRHKLVKEFPGKVKPDEPIPAHVLGNQWS
QSFDNLYHFVVPYPNATSFDITEVLKQKFTPDVVGVRGIFEVANDFFLSLGLPDMKMAYG
DKALIVKPKDREVVCHASAWDFSDGKDFRIKMCTNVDQKDFITIHHELGHINYYLNYKHQ
PLTFRTGANPGFHEAIGDVVALSVSTPKHMSTIGYLNFSESSHESTINYLTQIGLEKIAF
LPFGYLIDNYRWKVFDGTIPKDKLEYHWLKMRNEYQGITPPFNRSEMDFDPGAKYHVPGG
TPYIRYFVSFILQFQIHKTLCVEAGQYPQGPLHNCDIYKNAAAGTKFRKLMEAGFSKNWQ
DLLFEVTGTNKLDASAIKEYFKPLTDFLTELRTREGYPIGWSNTEFEKFYTPS
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atgggggttgcaaaaactctgtacctacttactgcattacttgcaacattgtggcatccc
actgcatgcaccacacccaagttagcagggaaggcgacggacgacgaagcaagacaatat
cttgaagaagtactagaatccaggtactcaggggcatgcaatacccaaataacgacgcga
tgggcttatataaccaacgtcacgacagaaactgcagaagcttcgacggctgcagacacg
gcatttttagaattccaggctagtattcaggcagaaattttggcgaatttctcaaactgg
agagagttcaatgactctcaagttcgacgtgaattccaatatttgtcgataaaaggacct
gcgcgaatgccccccacagatgtttcaaatatgaataaattgcaaagcagtatggaaact
gcatatgcaaccgctgctgtttgtgatttccgaaattctagtaaatgcgacttgcgccta
gacccagaaattgaagaaaaattgcgcacagccacggattgggacgaattggcatattat
tggactgaatggcacaatgctatgagcaatgccgtcagacctgccaattacacgcttttt
atcagatggcaaaatgaaatggcaagggcaaacggttttaacgatatgagccaaatgtgg
ctgaccggatatgacgatgagtcccctgactttgatgctgttatattcaagagacagatg
cttgacatttgggaagagcttcgtccgtactacaacattttacacgcttatgtacgaatg
aagcttcggcgacttccagaataccaagaccgtatcaccaagtatggctatttgccagct
cacattttaggaaatatgtggggacaggactgggcgcatttggataataaaacgaagcca
ttccctaatgccccctctctcgacgccaccgacgccatgatcagagccaattacactacc
ctaaaaatgtttcaagaatccgacaagtttttcacagatttaggactcttgccaatgacg
ccagccttttggaataactcgatgctcgaaaggccttctgatggacgagaagtggtttgt
cacgcttcagccgaggacatgtgtctaggcaaaggaagcactgacttcagaatcaaacag
tgcacgaaggtgacgatggacgaccttgttaccgttcaccatgaaatgggtcacattgaa
tattttttgcaatatactgatgagcattatattttccgcgacggagcaaatccaggattt
catgaggcaatcggtgatgcattagctcttgcggtggtcacaccaaagcaccttcagtgc
gttctaaacctcgacctcggcttggatattgactgcagtaatacgaccgtgtatcaggct
gatacagttacagaaactgactacaactttcttttcattactgccctgcaaaagtttgtc
tttttcccattcgcaatttcaatggatagttggagatgggaagtatttgagggcaaaatg
tccgaatataactacaatacacgatggtgggaacttcgccaaaaaaatcaagggattgaa
ccccctttcccgagaaacgctagcgactttgatgccactgcaaaatatcacatcgtggct
aacgttccctacatcagatactttgtgagccatattcttcagttccaattctatgaagca
atgtgcaaggcggccggagagtttgacccagacaacaattcttcaaaacctttgtaccaa
tgcgacttttcggggagcagggatgcaggaactctcctcgggaatatgatgaaacttggt
tttacacgaggctggcccactgcactggaagcaataactggaagtcgcaacatgtccatt
gcgccattgcttaactatttcaaaccaattttcgaccttatgcagaaggatctcgtcgac
aatggagaagagccatgttttggaccatcttgtgaagaagttgccaagaaatatttgtcc
gaaaagctggaaaaggaggcttccgcccttcacacaaagtctgcccatgcagaatgggca
tattccaccaatttgacaaacgatgaagcgaaaaaggaagtagagaaagtaaatttagag
tattcaagctacgaaaagaaagaatggaaggagtacatcagccaatttaaatatgagacg
ttcaacgattcagccatacgacgacaatttaaattcttaaatgacattggaatttctgca
ttgaatgaatctgatgtggttgagtttaacacagtctcgtcggaaatgaaaaagatctac
ggaactggcaaaatctgcccattttctatgcaagagtgtaatataactaccaatggtctc
tccctaaatccagatttggaggaaatccttgccaaggtcaaggattatgacgagatggcc
tatgtctggaagagttggcgagatgcgacaggtgccaaaattcgcccgttgtactacaaa
tatatcgatcttcaaaataaagctgccaaagccaacggatatgacaatgctggagaatat
tggattcgaaagtacgagtccccggactttagaaaggatttggaagagctttggcaagac
gtgaaaccattatatgcagaattgcatgcatatgtaaggcacaaattggtcaaggaattc
ccaggcaaagtaaaacccgatgaacctatccctgctcatgtattaggaaatcaatggtca
caatcgtttgataatctataccattttgtcgtcccctatccaaatgctacatcctttgac
attaccgaagttttgaagcagaaatttaccccggatgtggttggagttcgtggaatattc
gaagtggccaacgattttttcctcagcctaggtctacccgacatgaaaatggcctacgga
gataaggcattgattgtgaaaccaaaggatcgcgaagttgtctgtcacgcgtcggcttgg
gatttcagcgatggaaaagactttcgaattaagatgtgcaccaacgttgatcaaaaagat
tttattactatccatcatgagctcggacatataaattattaccttaattataaacaccaa
ccattaacctttcgtacaggagctaacccaggatttcacgaggctataggagatgtcgtt
gctttatcagtgagcacgcccaaacacatgagcactattggttatcttaattttagcgaa
tcgtctcatgaatctacaatcaattacctcactcaaatcggtcttgaaaagattgcattt
cttccatttggatatttgattgacaactaccgttggaaagtatttgatggtacgattccc
aaggataagctagaatatcactggttgaaaatgagaaatgaataccaaggaattacacct
ccatttaatcggagcgaaatggatttcgaccctggagcaaagtatcacgtgcctggtggg
acgccgtacatccgctattttgtcagtttcattctacaattccaaattcacaagacctta
tgcgttgaagcaggtcagtatcctcaaggaccgctgcataattgcgacatttataaaaat
gctgcagcaggaaccaaattcaggaaattgatggaagctggtttctccaaaaattggcaa
gacctcttgtttgaggtcacaggaaccaacaagttggatgcatcggcaattaaagagtat
tttaagccgttgacagattttctgacagagttacgaaccagagaaggatatccaattggg
tggtcgaatacagaatttgaaaaattttacacaccaagttaa

DBGET integrated database retrieval system