KEGG   Folsomia candida: 110859194Help
Entry
110859194         CDS       T05043                                 

Definition
(RefSeq) probable 4-aminobutyrate aminotransferase, mitochondrial
  KO
K13524  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
fcd  Folsomia candida
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fcd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    110859194
   00650 Butanoate metabolism
    110859194
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    110859194
   00280 Valine, leucine and isoleucine degradation
    110859194
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110859194
Enzymes [BR:fcd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     110859194
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     110859194
Amino acid related enzymes [BR:fcd01007]
 Aminotransferase (transaminase)
  Class III
   110859194
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 489 aa AA seqDB search
MLRSLQILGRASSHKGVVVRGMASLNIAGEPSGPSMKTSMPGPKSKQLMDELNKLTQAGS
VQLFADYDKSYGNYLVDVDGNVFLDVYTQISSIPLGYNHPELFALFSDPHHIRTLVNRPA
LGVYPGGDWVQELKDSVLSVAPKGLKHVTTMACGSCSNENAFKAIFFWYRKQQRGGKDFT
PDELTSCMNNLPPGSPPLSILAFHGAFHGRTLAALTCTHSKAIHKIDVPSFDWPVARFPV
YKYPLEDNVGENKAEDKKCLANVEELIDIWKKKGNPVAGIIVEPIQAEGGDNHGSPEFFQ
GLQKLAKTKGVALLIDEVQTGGGPTGKMWGHEHFNLPETPDIVTFSKKMQTGGFYHKPEF
RPDQSYRIFNTWMGEPSKIQILNKILEIIKRDNVLENVQSTGSLMLKQLKEFQNKYPNHL
NSARGLGTFCAINCANGQLRDKIINLLREQGVQAGGCGENALRFRPTLVFQPKHASIFFD
KFETVLKKL
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgttacgttcactccagattctaggacgggcgtcttcccacaagggggtagttgttcgg
ggtatggcgtcgttaaatatcgcaggtgaaccttccgggccttccatgaagacgagcatg
cctggaccaaagtccaagcaactgatggatgaactcaacaaactcacgcaagcgggcagt
gttcaactttttgcagactatgacaaatcctatggcaactacttggttgatgttgatggg
aatgtgtttttggacgtgtacacccaaatctcgtccatccccttgggttacaaccatccg
gaattatttgccctcttctcagatcctcatcacattcgcactcttgtgaatcggcctgca
ctcggcgtttatcctggaggagactgggtccaagaactgaaggattccgttctctcggta
gcacccaaaggattaaaacacgtaaccacgatggcttgtggctcttgttccaacgagaac
gccttcaaagccattttcttctggtatcggaagcaacagcgcggagggaaggatttcact
ccggatgagctgacttcatgcatgaacaatttgccaccgggcagcccacctctttccatt
ctcgcctttcatggagcgttccatggcagaactcttgcggccttgacctgcactcattcc
aaagctatccacaagattgatgtcccctcgttcgattggcctgttgccagatttccagtg
tacaagtacccactggaggacaacgttggagagaataaggccgaggacaagaagtgctta
gccaacgttgaagagttgattgacatttggaagaagaagggcaatccggtggctggaatc
attgtggagcccattcaggccgaaggtggggacaatcatggatcccccgaatttttccaa
ggcctccaaaagttggccaagacgaagggtgtggctcttctcatagacgaggttcaaacg
ggaggaggacccacgggcaaaatgtggggccacgaacactttaatctccccgaaacgccg
gatattgtcacttttagcaaaaagatgcaaactggaggattttatcataaacctgaattt
agaccggaccaaagctatagaatttttaacacttggatgggagaaccctccaagattcag
atcctgaataaaattctggaaataattaaacgtgacaatgtgctggaaaatgtgcagagt
acgggatctctcatgctgaagcaactaaaggaattccaaaacaagtatccaaatcatctc
aactctgctcggggcttgggaacattttgcgccataaactgcgcaaatggacaactgcgt
gataagatcatcaacctcttgagagaacaaggtgtgcaagccggtggatgtggcgagaac
gcgctacgtttcagacccaccctcgttttccaacccaaacatgccagcattttctttgat
aaattcgaaactgtgttaaaaaaattgtaa

DBGET integrated database retrieval system