KEGG   Folsomia candida: 110859850Help
Entry
110859850         CDS       T05043                                 

Definition
(RefSeq) uncharacterized protein LOC110859850
  KO
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
fcd  Folsomia candida
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fcd00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    110859850
Enzymes [BR:fcd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110859850
Chromosome [BR:fcd03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110859850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 2075 aa AA seqDB search
MWISEEYRRNLSKMALELKLHSPAGVEPMIYTWPLNSVGSGKDRVDGGHEIAETIRWVCE
DFPELKIAMENNCLNDYLPQSFESMKNLCDRYNRAIDSILQLEKGTSKPKERLNKQPSRL
LLKHILQQVYNMAVTDPEKLNNYEPFSPEVYGETSFELICQMVDQIEISEDDVFIDLGSG
VGQVVLQVAASTKCQNCYGIEKAEIPSTYAMDMNTHFRRWMKWYGKVHSEYTLLKGDFLH
GDLQDLIKKATVVFVNNFAFGPTVDHKLKERFADLNDGARIVSSKTFCPLNFRITDRNLT
DIGTIMHVSELKPMKGSVSWTDKPVSYFLHVIDSTKLHRYFEKGKSGIREKEQASSSLHN
RGRSKSMNIDHSSSSHSSRQHLTNGIKINGLKSIETSSNDSNNSLPKENNNEDLSDVSDE
PSNGVVVGPTTRRAWSDWCSSRGKSSKENSEDDTVAPHSNRNNPKSGRGRPRGKKKVLRK
KLSRSNKVRKVKMDIKDDDDPCLEAMLADSKQLDINLPPPPIQTTARGGSTAGRKPKGRL
KKTKNKRGLKITGPKLSAIDFLHSQTLLSTSPQGKKLPAAKGTIDQKLTQLSSAATTGII
KHEEMPITTRNTPYALQKLLEMYKNQFLDAIETMKSPQYRRQLLDQVEVEKRRKEDLVIR
KDQLDKHIAKLISDSTKLLRSKLEELNIQGEGATADTLLSEARNIVMRHKEIQAEVTKLQ
NEVAKLEKSKEAFVEERKKEMLEKCRQAGIVNGATLPDSDLEKICRKFLMTEITATLSYR
KNLESRLAQYELDIVASEKEISALQQQHAVLQQHQKLQIVSVSPKSSSSSTATQQRKDKN
MARSRSQEWPDIPDIGKINENNPEMLAKKILETGRKIEAGKLPRKSPERIANCRRKSGNN
NSVVAMDHSSSYKDDTIPAPKVNFYEDRLKSIITSVLNEDPATGQQGQQGATSNNTIATP
TTSPYTNYGPKSVTGRSVTSTTSYSQNNLPTTPPRSSPNDGSSQKKKLQLSPDIILGYSN
NTRTPGKAALRTHLVNNSSPLEQQKVVRNLNFGPGNKPRSINDLMTNEIESSLGVTHHGR
CRTPLSSASPPVVRAVYSPISRPNSNENIPESLSSSSSGFQVSRATVLVNTQSKPGMDAG
MNEGLAAGLKARLLSLAKSSANSLEKTASRNEEASSSQLESTNPLLNSPLVKEKKLVEAA
NGRVTVEVVLQSSEGPEGLVPKSKNDNSSNSNGSVLQLVRKRVGEVNGISVPPKKQPTPD
IIGPPKTPTPTFPPSTPSPRPGSASTPLSRPSSAHHYTPELRNSPGLATLTPVNGYRSRV
PTPGGLMDDHGIGSSAPRADFDSTFDRILCFATNEVDKRRRSTEAAGMSPRNGHVSTTTG
NLKASDYNDRPKTPSATNGETSPDSGIGRDLPLSSLDHWNHSAEVDSFSKGRRHRENSIY
RRRSPTPPPMGIPRTPSPSRNDELYEDDLMDEPPPRIPTPGKGMDFKKMLQQSKMMVGNV
TPEVDSYRPVNKASSVDIKPKMEVDCKSNETSAVGEKVVEDRNSTASSAATITPIVNHNP
ASGSSSSDQQCHPKKRWNNWGHTGPVRPSSPQAGGSVDGRSSVASDCSSTADTGHIPITA
TTTNQGIPANNPVLNPGSTLHSSSSAMSAAASKFRPKGKGFDWNTEMRSGSPYNSSPSPN
SYAPQQQQQHSQGYPSSQTNNHLPLPPPNVKVTSTGIVPSIGQQHHQHPQHFHQQQQHAN
GPMGNMNIVPPQQQQQQPKSCVPLPIGRIPPPPPPPHSGKSILSAVDQVIMQTLNSGNRP
ATNNTTGNPSSSNFESSTYNNNLYKQQQTSSGNYNPTNHNHFNNGSNQKMVVPPPAAATG
YQPPHPPGGHGQSNSNNYHQANSYSQQQQPGQNNMYGTHQHHTNNSAPPTAGFGRQQAQP
HPSNSAYPVMQSPKIHPSAYAQQGAGGGSSSGGTGSYYNGGQHLGGNKAPYEHRNGYHRL
GPYPQSSSYSSSASHPPPPGSTNKGIHDMYPQQPHYNSHYNHTSSSRQQQAQPHHHLNSS
SASSSHHHQSHGLPQQGYNNNNHDHPHNQMLPTRR
NT seq 6228 nt NT seq  +upstreamnt  +downstreamnt
atgtggataagcgaagaatataggagaaatttgtcgaaaatggcgctagaattaaagcta
cacagccctgcaggggtcgaaccgatgatatacacttggcctctgaatagtgtcggaagt
gggaaggaccgggttgatgggggtcacgaaattgcggaaactataagatgggtctgcgag
gactttccagaattgaagatagcaatggaaaataattgcctgaacgattatctccctcag
tcgttcgaaagtatgaagaacctctgcgaccgctacaacagggcgatcgactctatcctt
caattggagaaaggaacctctaaaccgaaggagaggctgaacaaacagccttcccgactc
ttgctaaaacatattctgcagcaggtttacaacatggcggtgacggatccggaaaaattg
aacaattatgagcccttctctccagaagtgtatggagaaacatcgttcgaacttatatgt
cagatggttgaccagatcgagataagtgaggatgatgtttttatcgatttggggtccgga
gttggacaggttgtgttgcaagtggctgcatccaccaagtgccagaactgctatggaata
gagaaagcagaaatcccttcaacttacgctatggacatgaacacacatttccgtaggtgg
atgaagtggtatgggaaagttcatagtgaatatacccttttgaagggagactttctccac
ggtgatctgcaagatttgattaaaaaggcgacagtcgtgtttgttaataatttcgccttt
gggcccacggtggaccacaaattaaaggagcggtttgcggatttaaatgacggtgctcgt
attgtttcctcaaagacattttgcccactgaatttcagaataacggatcggaatttaacc
gacattgggactattatgcatgtatcggaactaaaaccaatgaagggatccgtctcctgg
acagacaagccggtctcgtattttctgcatgtaattgactccaccaagctgcatcgatac
tttgaaaagggcaagtccggcattagagagaaagagcaagctagcagttcccttcacaat
cgtggacgcagtaaatccatgaacattgaccatagttcatcctcccactccagcagacaa
catttgacaaatggaataaaaatcaacgggctaaaatcgatcgaaacaagttcaaacgat
tcgaataattcattaccaaaagagaataataacgaagatttgagtgacgtaagtgacgaa
cccagcaacggagtcgtcgttggaccaacgacacgcagggcttggtcagattggtgctct
agtagagggaaaagttcgaaggaaaatagtgaagacgacacggttgctccgcattctaat
cgaaacaatccaaaatctggcagggggaggcctcgcggaaagaagaaagtgttaagaaag
aagttatccaggagtaataaggttagaaaggtcaagatggatatcaaggatgacgatgac
ccatgtttagaagcaatgttggccgattctaaacagttggatattaatttacctcctcca
cccattcaaaccactgcgagaggtggcagtacggccggaaggaagccgaagggacggttg
aagaagacaaagaataagcgggggctgaaaataactggaccgaagttgtcagcgattgat
tttctgcacagccaaacgctccttagcacgtctcctcaaggaaagaaactgccggccgca
aaaggtacgatagatcaaaaattgacccagctaagcagcgctgccacgacgggaattata
aaacatgaagaaatgcccataacaactcgaaacacgccgtacgcattgcaaaagcttctc
gaaatgtacaaaaatcaattcttggatgctatcgagaccatgaaatcgcctcagtacagg
cgacaattgctggatcaagtggaggttgaaaagaggaggaaagaggacctcgtcatccgg
aaagaccagctggataaacatattgccaagctgatttcggactctacaaagttattgaga
tcgaaactggaagaacttaatattcagggtgagggagcaacggcagacacacttctttct
gaagctcgtaatattgtcatgcgccacaaggaaatccaagctgaagtgaccaagttgcaa
aacgaagtcgcgaaactggagaaatctaaagaagcgttcgttgaagagagaaagaaagaa
atgctcgaaaaatgtcgtcaagcgggtatcgtaaacggagcaacccttcccgactctgat
ctggaaaagatctgtcggaaattcctcatgaccgaaatcacggccaccttatcctatcgg
aaaaacttggagagtcgtctggcccagtatgaattggacattgtggcctcagagaaagaa
atcagtgccctacaacaacaacacgctgtcctacagcagcaccagaaactacagatcgtg
tcagtgtcgccaaaatcatcctcttcaagtactgcaacacagcaacggaaagataagaat
atggcacgcagtagatctcaagaatggccggatatccctgacattgggaaaattaacgaa
aataatccggaaatgttggcgaaaaagatacttgaaactgggaggaaaattgaggctgga
aaactcccaaggaagagtccagagaggattgcgaattgtaggaggaaatctggaaataac
aacagtgtggtagcgatggatcattcttcttcctataaagatgacactattcctgccccc
aaagtgaatttctacgaggatcgattaaagagtattattacatctgtgctgaatgaagat
ccggcgaccggccagcaaggtcagcaaggtgcaacatcaaacaacacgattgccactccg
actacgtccccatacacaaattatgggccgaaatcggtgacgggcagaagtgtgacttct
actacttcgtattcacaaaataacttgccaacaactccgcctcggtcctcccctaatgat
ggcagctcacaaaagaagaaactccaactttctccagatatcatccttggatacagtaac
aatacccgcactcccggcaaagccgctcttcgcacgcatctcgtcaataactcttctccc
cttgaacaacagaaagtggtgcgaaatctcaacttcggtcctgggaataaacctcgctca
atcaacgacttgatgacgaatgagattgagagttcgttaggagttacacaccatgggcga
tgccgtaccccgttgagttccgcttcacctcccgttgttcgagcagtatattccccaatt
tcaagaccaaattcgaacgagaacattcccgaatcgctgtcgtcgtcgtcatctggattc
caagtttctcgagccaccgtgttagtgaacacacaatccaaacctggaatggatgcaggg
atgaacgaaggactcgctgcggggctaaaagcgaggttactatcgcttgcgaaatcgtct
gccaacagtttagagaaaactgccagtcggaatgaggaggcttcatcgtctcaacttgaa
agtacaaacccgttgctgaattcgcctcttgtgaaagagaagaaactcgtagaggcggcg
aatggacgtgtcacggtggaagtcgtccttcaaagttcagaaggtcccgagggtctcgtc
ccaaagagcaagaacgataacagcagtaattccaacgggagcgtgttacaattggtgcga
aagagggtcggagaagttaatggaatttcggtcccacccaagaagcaacccactcctgac
atcataggaccgccaaagacaccaactcctacatttccaccatctactccaagtcctcga
cctgggtcggcttcgacaccgctatctcgcccatcctctgcgcatcattacactcctgag
ctgaggaattctccaggactggcgacactgacgccggtcaatggctatcgaagcagagta
ccgacaccgggaggattgatggacgatcatggtattggaagctcagctcctcgagctgat
tttgatagcacgttcgaccggattctctgtttcgcgacgaacgaggtggataaacgccgc
cgaagtactgaagctgccggaatgtcacctagaaatgggcacgtgtccaccaccacgggc
aacttgaaagcttcagattacaatgacagaccaaagacaccctccgccacgaatggggaa
acgtcacccgattctgggatagggcgcgatctcccactctcctcattggatcattggaac
cactccgctgaagtggactctttttcaaaagggagacgtcaccgagagaatagtatttac
agaagacgatctcctaccccaccaccgatgggaatacctcgcacgccgtctccatctcgg
aacgatgaactatacgaggatgaccttatggatgaaccacccccacgtattcctacccct
ggaaaagggatggattttaagaaaatgctacaacaatcaaaaatgatggtggggaatgta
actccagaagtggattcctatcgccctgtaaacaaggcatcatccgtagatattaagccg
aaaatggaggtggattgcaaaagtaatgagactagtgctgtaggggagaaagtagtagaa
gacagaaattctacagcgtcatcagctgcaactataacaccaatagttaatcataatccg
gcaagtggttcttcttcttcggatcagcagtgtcatccaaagaaacggtggaacaattgg
ggtcacacgggaccggtgagaccatcttcaccacaggcaggaggatctgttgatgggaga
agcagtgttgcgtcggattgtagttctacagcagatacgggtcatattccgattactgcg
acgacgactaaccaaggcattcctgctaacaatcctgtgctaaaccctggttctactctg
cattcaagtagcagtgctatgagtgcggcagcatcgaaatttcgacccaaggggaaaggg
tttgattggaatacagagatgcgtagtgggagtccttataattcgagtccttctcccaat
tcgtacgccccacaacaacagcaacagcactctcaaggttatccgagtagtcaaactaat
aatcacctcccacttccaccgcctaacgtcaaagtaacttccaccggaattgtgccaagc
attggacagcaacatcatcaacatcctcagcattttcatcagcagcaacaacatgctaat
ggaccaatgggaaatatgaatatcgtcccacctcagcagcaacagcaacagccaaagtct
tgtgtccccctcccaatcgggcgaatcccaccaccacctccaccccctcattcgggcaag
tcgattctttctgccgttgaccaggtgataatgcaaaccctgaatagtggaaatagacct
gcgactaacaacaccactggcaatccttcgtcgtccaatttcgagtcgtcgacttataat
aataacctgtacaaacagcagcagacttcttcgggaaattacaaccccacaaatcacaac
catttcaataacggttcaaatcaaaaaatggttgtgcccccacctgccgctgcaactggc
tatcaaccacctcatcctcctggtggacatggtcagtcgaatagtaataattaccaccag
gccaactcgtactctcagcagcaacagccaggccaaaataacatgtacgggacccaccag
caccacactaacaattctgctcctccaactgcaggatttggacgacagcaagcacaacca
cacccctcgaattcggcctacccagtcatgcaaagccctaaaatccatccatccgcatac
gcacaacaaggggctggaggaggcagtagtagtggtggtactggttcgtattacaatggt
ggccagcacttggggggaaataaggcaccatatgagcatcgcaatggatatcaccgacta
ggaccttacccacagtcatcatcctactcgtcgtccgcatctcatccccctccacccgga
agtactaataaggggattcacgacatgtacccacagcagcctcactataactcccactac
aaccatacctcatcctctcgccaacaacaagctcaaccacaccatcatctcaattcctcg
tccgcgtcgtcctcccatcatcatcaatctcatggacttccacaacaaggatataacaat
aataatcatgatcatccccataaccaaatgctgccaacgcgtcggtga

DBGET integrated database retrieval system