KEGG   Falco cherrug (Saker falcon): 102046316Help
Entry
102046316         CDS       T02911                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:fch00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102046316 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102046316 (CDC23)
   04114 Oocyte meiosis
    102046316 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102046316 (CDC23)
Ubiquitin system [BR:fch04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     102046316 (CDC23)
Chromosome [BR:fch03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    102046316 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 563 aa AA seqDB search
MNQGPGAGQRAGCGRVSPRRASELAFALDPLPLSELPPPPALTEEDARDLDAYTLAKSYF
DLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEALREL
RVELSKKHKARELDGFGLYLYGVVLRKLDLVKEAIDVFVEAAHVLPLHWGAWLELCNLIT
DKEMLKFLSLPDTWMKEFFLAHIYTELQLIEEALQKYQSLIDAGFSKSTYIISQIAVAYH
NIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRSMKPELSYLAHNLCEIDKYRVETC
CVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEV
NKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKK
CYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIYSCGEIVEHLEVSTAFR
YLAQYYFKCKLWDEASACAQKCCTFNDTREEGKALLRQILQLRNQGETSSTDIAAPFFLP
ASLSANNTPTRRVSPLNLSSVTP
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagggcccggggcggggcagcgggccgggtgcggacgggtctctccccgcagg
gcctccgagctggccttcgccttggacccgctgccgctgagcgagctgccgccgcccccc
gcgctcacggaggaggatgctcgtgatctggatgcctatacattagccaagtcttacttt
gatctaaaggagtatgacagggctgcctattttctgcggggctgcaagagtcagaaagct
tacttcttgtatatgtactctagatacctgtcaggggaaaagaagaaggatgatgagaca
gtggatagtttgggacctctggaaaaaggacaggtgaaaaatgaagctttacgtgaattg
agagttgagcttagcaagaaacacaaggcacgggaactggatggatttggcctttatcta
tatggggttgtgctgcggaagctggacctggtgaaagaagcaatagatgtgttcgtggaa
gctgctcatgtcttacctttgcactggggagcctggctggaactttgcaacttgattaca
gataaagagatgttgaagttcctgtccttgccggatacatggatgaaagagttctttctt
gcacacatttatacagagctgcagctgatagaggaggctctgcagaagtatcagagtctc
attgacgcaggattttccaaaagcacttacatcatctctcagattgcagttgcctaccac
aatatcagagatattgacaaagctttatccatctttaatgagctaaggaaacaagatcct
tacaggatagaaaacatggacactttctccaacttgctgtatgtaaggagcatgaagcct
gagttgagctacctggctcacaatctctgtgaaatagacaagtatcgtgttgagacctgc
tgtgtaattgggaattattatagcttgcgttcccagcatgaaaaagcagcactctatttc
cagagggccttgaaactgaatcctcgttatttgggagcctggacactcatgggacatgag
tatatggaaatgaagaacacatctgcagctatccaggcttacagacatgcaatagaggtg
aacaaaagggactacagagcgtggtatggcttggggcaaacctatgaaatcctcaaaatg
ccattttactgtctctattactatcgacgggcccaccagctcagaccaaatgattctcgt
atgctggttgctctaggagaatgctatgagaaactcaatcagttggtggaagctaaaaag
tgctattggagagcttatgcagtgggagatgtggagaaaatggcactggtgaaactagca
aagctgcacgaacagctgaatgaatctgaacaggcagctcagtgctatatcaaatacatc
caggatatctattcctgtggggagatagtggagcacctagaagtcagcactgccttccgt
tacttggcccagtactacttcaagtgcaagctctgggatgaagcctcagcatgtgctcag
aagtgctgtacgttcaatgatactagggaagaaggaaaggccctgctgcggcagatctta
cagcttcgcaatcaaggagaaacatcatccacagatattgctgctccctttttcctccct
gcatcattgtcagccaacaacactcctacacgtcgtgtctccccactcaatctgtcctct
gtaacaccatga

DBGET integrated database retrieval system