KEGG   Falco cherrug (Saker falcon): 102050152Help
Entry
102050152         CDS       T02911                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  
histone deacetylase 8 [EC:3.5.1.98]
Organism
fch  Falco cherrug (Saker falcon)
Brite
Enzymes [BR:fch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102050152 (HDAC8)
Chromosome [BR:fch03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     102050152 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 338 aa AA seqDB search
MVHSLIEAYSLLDQMKIVKPKVASMEEMASFHTDAYLQHLQKVSEEGDDDHPESVEYGLG
YDCPATEGIFEYAAAVGGATITAAQCLLDGKCKVAINWPGGWHHAKKDEASGFCYLNDAV
LGILRLRQKFDRVLYIDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVTDVGL
GKGRYYSVNVPIQDGIQDEKYYQICETVLKEVYAAFNPDAVVLQLGADTIAGDPMCSFNM
TPEGVSKCLKYVLQWQLATLILGGGGYNLANTARCWTYLTGVILGRTLSSEIPDHEFFTE
YGPDYVLEITPSCRPDRNEPQRIQEILNTIKGNLKHVV
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtacattcgttgattgaagcatattccttacttgaccagatgaagatagtcaagcca
aaagtggcctccatggaggagatggcgagcttccacacagatgcctacctgcagcacctg
cagaaggtcagtgaggagggggatgatgaccatccggagtctgtggagtatggactgggt
tatgactgtccagctactgaagggatctttgagtatgcagcagctgtgggaggagccacc
atcaccgcagcccaatgcctgctggacggcaagtgcaaggtagcaattaactggcctgga
gggtggcatcatgcaaagaaagatgaagcttctggcttctgttacctgaatgatgctgtc
ttggggattctgaggctacgccagaaatttgaccgtgtcctttatatcgatttggatttg
catcatggggatggtgttgaagatgcctttagttttacttcaaaagtcatgactgtttcg
ctccacaagttttcaccaggatttttcccaggcacaggtgatgtgacagatgttggtctg
gggaaaggtcgctattacagcgtgaatgtacctattcaagatggcattcaggatgagaaa
tattaccagatctgtgaaaccgtgctgaaggaggtgtatgctgcgttcaacccagatgca
gttgtgctgcagctcggggcagacaccatcgctggagatcccatgtgctctttcaacatg
acacccgagggagtgagcaagtgcctgaagtatgtcctgcagtggcagctagcaactctc
atcctgggaggaggaggctacaaccttgccaacacagctcgctgctggacatacttgact
ggggtcatccttgggagaacgctgtcctctgagatccctgatcacgagttcttcacagag
tatggtcctgattatgtgctggagatcacaccgagctgcagaccagaccgcaacgaacca
cagagaattcaagaaattcttaacactatcaaagggaatctgaagcatgttgtttag

DBGET integrated database retrieval system