KEGG   Falco cherrug (Saker falcon): 102055395Help
Entry
102055395         CDS       T02911                                 

Gene name
SETDB2
Definition
(RefSeq) SET domain bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102055395 (SETDB2)
Enzymes [BR:fch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102055395 (SETDB2)
Chromosome [BR:fch03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102055395 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102055395 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 707 aa AA seqDB search
MEENRTDLKTIWAQLGGRRVDIIFEQMQNVLLLLKQKIKNGTATNQEYCQASVLVNEANL
GDLLTLTNVGAVFDGDGIQETKPKWQRLLTDDNTANSVEGSHSKKEEMAKTGSGSKEASL
QIQDLPLNLQYQNHKCSSACLPNRVAGFYKGENPLKIPILFHFQRCHAKADCLSKSLDVN
YKAPCGRSLRSFQDVQNYLFQTECNFLFVDHFSFNTYVLLGRSTVNPEPLVFDFDISNGA
ESVPISFCNDLDHARLPYFKYRRTSWPHGYYLNNFSSVFVDSCDCTDGCIDRSKCACLQL
TARGCSRTSRSSATSHGYSYKRLEGPVPSGIYECSVLCRCDKMMCQNRVVQHGIQVRLQV
FNTERKGWGVRCLDDIDKGTFVCTYSGRLMSRAKVQVLGDDDQELREESAVSGRVCGFFS
KKRKLHTDCSETVIGRVQTGRSHILEKEESLSQTVDNENKSTLVHPRNLSNATARMPGTR
RVVFHNHPLKMENDTLAHIVSSDEDNSSQTHQSSKLTSGTKKGKEKSTQQQKEEHPMEIG
QTESADMDSAERKRKRLSLQGVDCDRADVLDDTSVTRPSKSVPLKGGTYHCKEEKHRQSK
HDTFCQKADDDRMLLKNANEENIYILDASKEGNVGRFLNHSCCPNLFAQSVFVETHNRNF
PWVAFFTNRHVKAGTELTWDYGYEAGSMPEVEISCQCGVQKCRKKTL
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atggaagagaatagaactgatttgaagaccatttgggcacaattgggaggtagaagagtg
gacatcatatttgaacagatgcaaaatgtactgctgttgctgaagcaaaagatcaagaat
ggaactgcgacaaaccaagaatactgtcaggcttcggtactggtgaatgaagctaatcta
ggtgatctcttaaccttgacaaatgtaggtgctgtatttgatggagatggcatacaggaa
accaaacctaaatggcaacgtcttcttacagatgacaacactgcaaactctgtagaaggt
tctcacagcaaaaaggaggagatggcaaaaacgggttcagggagtaaagaagcatctctt
caaattcaagatttacctttaaaccttcagtatcagaaccacaagtgctctagtgcatgt
cttcccaacagagtggcaggcttctacaagggtgaaaatcctcttaagataccaatcctg
tttcactttcaaagatgccatgcaaaagcagactgcctttcaaaatcactggatgtgaat
tataaagctccttgtggtcgaagtctgagaagctttcaagatgtgcaaaattatttgttt
caaacggagtgcaatttcttatttgttgatcacttctccttcaacacatacgtactgtta
ggcaggagtaccgtaaatcctgaacccctcgtatttgattttgatatcagcaatggagca
gagtctgtgcccatttccttctgtaatgatcttgaccacgcaagattaccttatttcaaa
tatcggaggacatcgtggccgcatggatattatctcaacaatttctctagcgtatttgtt
gattcatgtgactgcacagatggctgcattgataggtcaaagtgtgcatgcctacagcta
actgcaagaggctgtagtagaacttctagaagtagtgcaacatcccatggatacagttac
aaaagactagagggacctgttcctagtggaatttatgagtgtagtgtgttgtgcaggtgt
gacaagatgatgtgtcaaaacagagttgtacagcatggcattcaagtcaggttgcaagtg
ttcaacacggagaggaaaggctggggtgtccgctgcctagatgatatcgacaaggggaca
tttgtttgtacttactcaggcagattgatgagcagagctaaagttcaagtactgggagat
gatgatcaggagctgagagaggagagtgctgtgagtggcagagtctgtggctttttttcc
aaaaaaagaaaacttcacactgattgttcagagactgtgattggacgagtgcagactggc
agaagtcacattcttgagaaggaggaatctttgtctcagactgtagataatgaaaataaa
tcaaccctggttcatcccaggaatttaagtaatgcaaccgcgagaatgcctggaactaga
agggttgtttttcataatcacccgctaaaaatggaaaatgatacactggcgcacattgtg
agctcggatgaagataatagttctcagactcatcagtcaagcaaactaaccagtggaacc
aagaaaggaaaagaaaaatccactcagcagcagaaggaagaacatccaatggaaattgga
cagacagagtctgctgacatggacagtgcagaacgcaaaagaaagagactgtctctgcag
ggtgttgattgtgacagggcagatgtgctggatgacacatctgttacaaggccatccaaa
agcgtacccctaaaaggaggaacgtaccactgcaaagaggaaaaacacaggcagtcaaaa
cacgacacattttgtcagaaggctgatgatgacaggatgcttctgaagaatgctaatgaa
gaaaatatttatatactggatgccagcaaagaaggaaatgtgggtcgttttcttaatcac
agctgctgcccaaatctctttgcacagagcgtgtttgtagagactcacaacagaaatttc
ccatgggtggcgttcttcacaaacaggcatgtgaaagctggaaccgaacttacatgggat
tacggttatgaagctggaagcatgccagaggtagagatttcctgtcagtgtggagttcag
aagtgcaggaaaaaaaccttatag

DBGET integrated database retrieval system