KEGG   Falco cherrug (Saker falcon): 102059826Help
Entry
102059826         CDS       T02911                                 

Gene name
NSD2, WHSC1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
fch  Falco cherrug (Saker falcon)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fch00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102059826 (NSD2)
Enzymes [BR:fch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102059826 (NSD2)
Chromosome [BR:fch03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102059826 (NSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1368 aa AA seqDB search
MDFSIKRSSQLLTRKINYIKMKQVPEILGNTNGKTQNCEVNRECSVYLGKAQLSATLQEG
VMQKYNGHEALPFIPADKLKDLTSRVFNGESGAQDAKLRFEPQEIKGVATPPNTTPIKNG
SPEIKLKITKTYMNGKPLFESSICGDNGADVSQSEENEQKPANKERRNRKRSIKYDSLLE
QGLVEAALVSKTSSPTEKKAPAKRDPTQSIIKEDKVHLLKYNIGDLVWSKVSGFPWWPCM
VSADPVLHSYTKLKGQKKSFRQYHVQFFGDAPERAWIFEKSLVPFKEKDQFEQLCQESAK
QALTKAEKIKMLKPVSGKLRPQWEMGVKQASEAVGMTVEERKAKYTFIYVRDRPHLNPRV
AKEVGIAVEPLEEIDESSYSNEETTQNLKSMKESGIPNKRRRRTSKLSATDDTQESNQPG
TKNTTPQKSSEQAESKRGIGSPLNRKKTPGSTPRSRKGDAVSQFLVFCQKHRDEVVAEHP
DASSEEIEELLESQWNMLSEKQKARYNTKFAIVTSPKSEEDSGNLHGNKRNQKKRTKEPT
EDFEVQEAPRKRLRMDKQNNRKRETSNDKTAKTNSSKVTETSSSQKNQSATKNLSDACKP
LKKRNRASAAESSTLAFSKSSSPSASLTENEISDGQGDERSESPYESADETQTEVSISSK
KSERGAGTKKEYVCQLCEKTGDLLLCEGLCYRAFHVSCLGLSGRPAGKFICSECTSGVHT
CFVCKERKADVKRCVVSHCGKFYHEACVKKFHLTVFENRGFRCPLHSCLSCHVSNPLHPR
ISKGKMMRCVRCPVAYHAGDVCIAAGCAVIASNSIVCTNHFTAMKGKSHHAHVNVSWCFV
CSKGGSLLCCESCPAAFHPDCLNIEMPDGSWYCNDCRAGKKLHFQDIIWVKLGNYRWWPA
EVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYHGIKGIGK
VFKNALQEAEARFREIKLQREAKETQESERKPPPYKHIKVNKPCGKVQIYTADISEIPKC
NCKPTDENPCGFDSECLNRMLMYECHPQVCPAGERCQNQCFTKRQYPETKIIKTDGKGWG
LVAKRDIKKGEFVNEYVGELIDEEECMARIKYAHENDITHFYMLTIDKDRIIDAGPKGNY
SRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCKCGAP
NCSGFLGDRPKNSSTNASEEKGKKTKKRTRRRRTKNEGKKQSEDDCFRCGDGGQLVLCDR
KSCTKAYHLSCLGLVKRPFGKWECPWHHCDVCGKPSVSFCHFCPNSFCKEHQDGTVLNSM
LNGQLCCSEHVLGVDSVETQKSEKPRKKLNKLKPKRKQRNRWMRAECK
NT seq 4107 nt NT seq  +upstreamnt  +downstreamnt
atggactttagcatcaaaagaagttctcaactgttaactcgaaaaattaactacatcaaa
atgaagcaggtaccagagatccttggaaataccaatgggaaaactcagaattgtgaagtg
aatcgtgagtgttctgtctacttgggcaaagcacaactttctgccaccctacaagaaggt
gtcatgcaaaaatataatggccatgaggctcttccgtttattccagctgataaattgaaa
gatctaacctctcgtgtgtttaatggcgagtctggggcccaagatgccaagctgcgcttt
gaaccccaggaaatcaagggagttgcaacaccacccaacactactcctatcaagaatggc
tctccagaaattaagctgaaaatcactaaaacatacatgaatggaaagcctctttttgaa
tcttccatttgtggagacaatggtgcagatgtgtctcagtcagaggaaaatgaacaaaag
ccagcaaacaaggagaggagaaacaggaaaagaagcataaaatatgactccttacttgag
cagggtcttgttgaagcagcactagtatcaaagacttcaagccctactgaaaagaaggct
cctgctaagagggatccaactcaaagtatcatcaaagaagacaaagtccatctgttgaag
tataatataggagatctagtgtggtcaaaagtgtctggtttcccatggtggccatgtatg
gtttctgctgatcctgttcttcattcctacactaaactaaaaggacagaaaaagagtttt
cgtcaatatcatgttcagttttttggagatgccccagagcgagcctggatatttgagaag
agccttgtgcccttcaaagaaaaagaccagtttgaacagttatgccaggaaagtgcaaaa
caagccctcactaaagcagagaaaataaagatgttaaagcctgtttcagggaagctgcgg
ccacagtgggagatgggtgttaaacaagcaagtgaagcagtaggcatgacagtggaagaa
cggaaggccaagtacaccttcatctatgttagggacagacctcatcttaatcctcgagtg
gcaaaggaagttggcattgctgtggaaccgttggaggagatagatgagtcatcttactca
aatgaagaaaccactcaaaatctgaaatcaatgaaggagtctggcattcctaacaagagg
aggagaaggacatcaaaattgtctgccactgatgatacgcaagaaagcaatcagccaggg
actaagaatactactcctcaaaagtcatctgaacaggcagaatccaaaagagggataggc
tcccctctcaatagaaagaaaactccaggatctactccacgaagccgaaagggcgatgca
gtatctcagtttttggtcttttgtcagaagcacagagatgaggtggttgctgaacatcca
gatgcttcaagtgaggagattgaagaattgctggaatcgcagtggaacatgcttagtgaa
aaacagaaagctcgctataacacaaagtttgccatagtgacctctcccaaatctgaagaa
gactctggtaacttacatggaaataaaagaaaccaaaaaaagaggacaaaggaacctaca
gaagattttgaagttcaggaagcacctaggaaaagactcaggatggataaacagaataat
cggaagagggagacaagcaatgacaaaacagcaaaaacaaactcttctaaggtcacagaa
acctcctcttcacaaaagaaccagtcagcaacgaaaaatctgtctgatgcttgtaaacct
ctgaagaagcgaaatcgggcttcagcagcagaatcttcaactcttgcttttagcaagagt
tcatctccttcagcttccttaactgagaatgagatctccgatggccaaggagatgagcgg
tcagagtctccctatgaaagtgctgatgaaactcagactgaagtgtctatatcatccaaa
aaatctgagcgaggagcaggaacaaaaaaagaatatgtgtgtcagctgtgtgaaaaaaca
ggtgatctcctactgtgtgaaggactttgctatcgagcttttcatgtaagctgccttggc
ctctctggaagaccagcaggaaaattcatttgtagtgaatgtacatcaggtgtgcatacc
tgttttgtgtgtaaggagagaaaggcagatgtgaaacgctgcgtcgtatcccattgtgga
aaattctaccatgaagcttgtgtgaaaaaatttcatcttactgtgtttgagaacaggggg
tttcgatgtcctctccacagctgcctgagttgtcatgttagtaaccccttacatccacga
atttcaaaaggaaagatgatgcgttgtgttcgctgtcctgttgcataccatgctggagac
gtttgcattgccgcgggatgtgcagtcatcgcttccaacagcattgtttgtacgaatcat
ttcactgccatgaaaggaaaaagtcatcatgcgcatgtcaatgtgagctggtgctttgtg
tgttcaaaaggaggaagcttgttgtgctgcgagtcatgtcctgcagcgtttcacccagac
tgtttaaacattgaaatgccagatgggagctggtactgcaatgactgcagggcagggaag
aagctccatttccaggatattatttgggttaaactgggaaattacagatggtggcctgca
gaagtttgccatccgaaaaacgttcccccaaatatccagaaaatgaagcatgaaatcgga
gaatttcctgtgtttttctttggttctaaggattactattggacgcaccaagcacgggtg
ttcccttacatggagggagacagagggagtagataccacgggatcaaaggaattggaaaa
gtcttcaaaaatgctttgcaagaagctgaagctcgatttcgagaaataaagctacagcga
gaagccaaagaaacccaagaaagtgaacgtaaacctccaccatacaagcatattaaggtc
aataaaccttgtggtaaagtgcagatatatactgctgacatttctgagattcccaagtgc
aactgcaaacccacagatgaaaacccttgtggctttgactctgagtgcctaaatcggatg
ctgatgtacgaatgccatccacaagtttgtccagctggagaacggtgccaaaaccagtgc
tttacgaaacgtcagtaccctgagacaaagatcatcaaaactgacggcaaagggtggggt
ctggttgctaagagggacattaaaaagggagagtttgtgaatgagtatgttggtgaactc
attgatgaagaggaatgtatggcaagaatcaaatatgcacatgaaaatgacatcacccac
ttctatatgcttactattgataaggaccgtattattgatgctggccccaaaggaaattat
tctcggtttatgaatcacagctgccaaccaaattgtgaaaccctaaaatggacagtaaat
ggagacacccgtgtcggcctgtttgctgtgtgcgacattcctgcaggtacagagttgact
tttaattacaaccttgactgtctgggcaatgaaaaaacagtctgcaaatgtggtgcccca
aactgcagtggatttcttggggacagaccaaagaattcttccactaatgcctcagaagaa
aaaggcaaaaagaccaaaaagagaacacggagacgcagaacgaaaaatgaagggaagaaa
caatctgaagatgattgtttccgttgtggtgatggaggccagctggtattgtgcgacagg
aaatcttgtactaaagcttatcatctctcctgtcttggtttggtgaaacgtccttttggg
aagtgggagtgtccttggcaccactgtgatgtttgtggcaaaccttctgtttctttctgc
cacttctgcccaaattctttctgcaaggaacaccaagatgggacagtactaaattctatg
ttgaatggacagttatgctgctctgaacatgttctcggggtggattctgttgaaactcag
aagtctgagaaaccccgcaaaaaactgaacaagttgaagcctaagagaaagcagaggaac
agatggatgagagctgaatgcaaatag

DBGET integrated database retrieval system