KEGG   Flavobacterium columnare: FCOL_10440Help
Entry
FCOL_10440        CDS       T01653                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
fco  Flavobacterium columnare
Brite
Translation factors [BR:fco03012]
 Eukaryotic Type
  Elongation factors
   FCOL_10440
 Prokaryotic Type
   FCOL_10440
Mitochondrial biogenesis [BR:fco03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    FCOL_10440
Exosome [BR:fco04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   FCOL_10440
  Exosomal proteins of breast cancer cells
   FCOL_10440
  Exosomal proteins of colorectal cancer cells
   FCOL_10440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 Ribosomal_S8 cobW
Motif
Other DBs
NCBI-ProteinID: AEW86895
UniProt: G8X5Q1
LinkDB All DBs
Position
complement(2467694..2468881)
Genome map
AA seq 395 aa AA seqDB search
MAKESFNRSKPHLNIGTIGHVDHGKTTLTAAITKVLSDAGYCQAKSFDQIDNAPEEKERG
ITINTSHVEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPRIVVFMNKVDMVDDAELLELVEMEIRDLLSFYEYDGDNGPVVQGSALGGLN
NDPNWVPKIIELMEAVDAWIEEPVRDNEKPFLMPVEDVFTITGRGTVATGRIETGVANTG
DPVEIIGMGADKLTSTITGVEMFRKILDRGEAGDNVGLLLRGIDKADIRRGMVICKPGSV
KPHAKFKAEVYILKKEEGGRHTPFHNNYRPQFYVRTTDVTGTISLPEGVEMVMPGDNLTI
NVELLQPIALSVGLRFAIREGGRTVGAGQVTEIVD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaagttttaatcgttcgaaaccgcacttaaatatcggtactatcggacac
gtagaccacggaaagactactttaactgctgcgatcactaaagtattatctgatgcaggt
tactgtcaagctaagtcattcgaccaaatcgataacgctccagaagagaaagaaagaggt
attactattaatacatctcacgtagaatatgaaactgctaaccgtcactacgctcacgta
gactgtccaggtcacgcggattacgttaagaacatggttactggtgctgctcaaatggac
ggtgctatcttagtagttgctgctacagatggtccaatgccacaaactcgtgagcacatc
ttattaggtcgtcaggtaggtattcctcgtatcgttgtattcatgaataaagtggatatg
gttgatgatgctgagttattagagttagtagaaatggaaatccgtgatttattatctttc
tatgaatacgatggagataatggtccagttgttcaaggttctgctttaggtggattgaat
aacgatccaaactgggttccaaaaattattgaattaatggaggctgttgatgcttggatt
gaagagccagttcgtgataacgaaaaaccattcttgatgccagttgaggacgtatttaca
attacaggtcgtggtacagttgctacaggtcgtatcgaaacaggtgttgctaacactgga
gatccagttgaaatcatcggtatgggtgctgacaagttaacttctactattactggggtt
gagatgttccgtaaaatcttagatagaggtgaagctggagataacgtaggtttattatta
cgtggtattgataaggctgatatccgtcgtggtatggttatttgtaagccaggttcagta
aaaccacatgctaaatttaaagcagaggtttatatcttgaaaaaagaagagggaggtcgt
cacacgccattccataataactaccgtcctcagttctatgttcgtacaactgacgtaaca
ggtacaatttctttgccagaaggtgttgagatggtaatgccaggtgataacttaacaatc
aatgttgagttgcttcaaccaatcgctttatcagtaggtttacgtttcgctatccgtgaa
ggtggtagaacagtaggtgctggtcaggtaactgaaatcgttgactaa

DBGET integrated database retrieval system