KEGG   Fusarium graminearum: FGSG_03842Help
Entry
FGSG_03842        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
fgr  Fusarium graminearum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FGSG_03842
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     FGSG_03842
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 460 aa AA seqDB search
MKLLQLAALVASISPFASAADANAWKSRNIYFALTDRVARSDSDSGGNACSNLGNYCGGT
FKGLEAKLDYIKGMGFDAIWITPVVENTDGGYHGYWAKDLYEVNAKYGTKDDLKSLVKTA
HSKNIYVMADVVANHMGKGIQDHRPEPLNQQSSYHSPCAIDYNNQNSIEQCEIADLPDLN
TGSETVKKVLNDWISWLVTEYSFDGIRIDTVKHVEKSFWPDFQKAAGVYAIGEVWDGSPD
YLAGYSKVMPGLLNYAIYYPMNRFYQQKGDPSAVVDMYNEISQKFDDPTVLGTFIDNHDN
PRWLSQKNDKALLKNALAYVILSRGIPIVYYGTEQGYAGGNDPANREDLWRSSFKTDSDL
YQTISKLGKARSAVGGLAGNDQKFLKSNDSALIWSRANNDLIVVTMNRGQGFSGQYCFNT
GANNKTWERVLGQGTVKSDGSGQLCVSYTNGEPEVLVAAN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcttcaacttgccgccctggtggcttccatcagcccattcgcgagcgcagct
gatgcaaacgcctggaagtcgcgaaacatttactttgccctcacagatcgtgttgcacgc
agtgatagtgatagcggtggcaatgcctgtagcaatctcggaaattattgcggtggcacc
tttaagggtcttgaggccaagctggactacatcaagggcatgggcttcgacgctatctgg
atcactcctgttgttgagaacacggatggtggataccacggatactgggctaaggatctg
tacgaggtgaacgcgaagtatggaaccaaggacgacttgaagagtttggtcaagactgct
cacagcaagaacatctacgtcatggccgacgtggtagcaaaccacatgggtaaagggatc
caagaccacagacctgagccgctcaaccaacagagctcttaccactctccttgcgcgatc
gactacaacaaccagaacagcatcgagcagtgtgagattgctgaccttcctgatctcaac
actggcagtgaaacagtcaagaaggtcctcaacgactggatctcatggcttgttactgaa
tacagcttcgatggtatccgcatcgataccgttaagcacgttgagaagagcttctggcct
gatttccagaaggcggccggtgtctatgccattggcgaagtctgggatggaagcccggat
tacctcgctggctactcaaaggtcatgcctggtctgttgaactacgccatttactacccc
atgaaccgcttctatcagcaaaagggtgacccatctgccgtggtcgacatgtacaacgag
atcagccaaaagttcgatgatcccacggttctcggaacgtttattgacaaccacgataat
cctcgatggttgagccagaagaacgacaaggccctcctcaagaatgcccttgcctatgtt
atcctctctcgcggtattcccattgtctactatggtaccgagcagggttacgctggaggc
aacgaccccgccaaccgcgaggatctctggcgcagcagcttcaagacagactcagacctt
taccagaccatctccaagctcggaaaggcccgctctgccgttggtggtctcgcaggaaat
gatcagaagttcctcaagtccaatgacagcgcactcatctggagccgtgctaataacgat
ctgatcgtggtgaccatgaaccgaggacagggattctctggacaatactgtttcaacact
ggcgcgaacaacaaaacttgggagagagtgctaggccagggtactgtcaagtctgacggc
agcggccaactttgtgtcagctacaccaacggcgaacctgaggttctcgttgcggcgaac
tag

DBGET integrated database retrieval system