KEGG   Fusarium graminearum: FGSG_04157Help
Entry
FGSG_04157        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fgr  Fusarium graminearum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FGSG_04157
Enzymes [BR:fgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FGSG_04157
Transporters [BR:fgr02000]
 Other Transporters
  Pores ion channels [TC:1]
   FGSG_04157
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2
AA seq 261 aa AA seqDB search
MSQPDPKRVKTDDEAPYELIYWPTIPGRGEFVRLVFEEAGVPYKDIAQNQEEGFKAVKEL
TATDNIGDDHNPPALAPPALRHGDLLICQTTNILLYVAPKVGLAPKEGNGLYHLNQIALT
IMDGLVNELHDTHHPIDISAYYDDQKEEAKKRSSFFTKERIPKYFKYMQRLLDAKTSGEG
PWLYGDSLTYADLVLFQAVDGTKFAFPKSVEKLEKSGEYDGVFKIYEAVKERPNISKYLQ
SDRRYAYSDGIYRYYPELQEE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaacctgatccgaagcgcgtcaagaccgatgacgaagctccctacgaactcatc
tactggcccaccattccaggccgcggggaatttgtccgccttgtctttgaagaagccggc
gtcccctacaaagacattgcgcagaaccaagaagagggctttaaagccgtcaaggaactc
actgccaccgataacatcggcgatgatcacaacccgcctgctctagctcctccggcactc
aggcacggcgatttactcatctgccaaactacaaacatccttctctatgttgcacccaaa
gttggattggcgcccaaggagggcaatgggttataccacctgaaccagattgctctgact
atcatggatggtcttgtgaatgaactccatgatactcaccaccccatcgacattagcgcg
tactatgacgaccaaaaggaggaggccaagaagagatctagcttctttaccaaagaacgg
attcccaagtacttcaagtacatgcagcgactgctcgatgccaagaccagtggagaagga
ccatggttatacggcgatagtcttacgtacgcagacctcgtactgttccaggctgttgat
ggtaccaagtttgctttccccaaatctgtcgagaaattagaaaagtctggtgaatacgat
ggtgttttcaagatatacgaagccgtcaaggagagacccaacatcagcaaatatctccaa
agtgatagacgctacgcctactcggatggtatttaccgatactaccctgagctgcaagaa
gagtaa

DBGET integrated database retrieval system