KEGG   Fusarium graminearum: FGSG_10960Help
Entry
FGSG_10960        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
Organism
fgr  Fusarium graminearum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 1097 aa AA seqDB search
MASNQVKNGAVASNGYGKEKSPSSASSSQKNEVPAPPHNKSEGLVKSIKKLRLASKRPLP
TEMGDGSYRQVATRPGLKQDVRRLRGKDLKTLLEIISSKLKGEMQQDDKTMIMERTIQLV
ANLSDHSKVQEALTNSFIAQLWNSIDHPPMLYMGNKYRFRQPDGSWNNPYLPQLGAARTP
YSRTVRPKGMSLGAQPDPEAIFESVFARGIFRKNPNNVSSILWYWATIIIHDPDQNDSSS
YLDLAPLYGSTVKDRDSIRTFKDGQLKPDCFADKRLIGNPPGVPIILIMFNRFHNHVATN
LADINEGGRFSKPGAHLDAEAAAAAWKKRDEELFETARLVTSGLYINITLIDYVRNIINL
NRVDTTWTLDPRQEMGVSVGTKNLSESGTGNVVSAEFNLCYRWHSCLSEMDEKWVEDFYT
ELLGENYGPMNLQTMMRALKAFEATVAEEPSERTFGGFKRGPDGKFNDDELVEALATAIE
QPGGAFGGRNVPRIMKPIEMLGIMRGRKWNLAGLNEFRKHFGLKAYDTFEDINSDPEVAD
ALRNLYQHPDYVELYPGIVAEEAKTPMVPGVGIAPTYTISRVVLSDAVALVRGDRYYTID
YHPRNLTNWGYKEVDYDLNINHGCVFYKLFLRAFPQHFKGNSVYAHYPMVIPTENHKILT
DLKRVDRFDFSRPAPTATRINIVGYKAAKYILEDQAKYRVCWEEGLKHLMGEGGGRFMLS
GDTALHAQQRKCMGRLLYNDTWRNAVKSFYSTTAEMLLNEKSYTLAGKKQVDVVRDVGNV
AHTHFVARMFNLPLKTKQNPKGVFSEQELYMILAVIFVCIFFDIDPAKSFPLRQAAREVA
QQLGKIVEMNVKLATSVGIKGLFTSKPNKNDDPLAAYGENMAKGLKKAGLSIDDIVWSQI
LPTAGAMVPNQAQVFAQTLDWYLSPAGEKYRPELHRIAALETGDETDALLLGYAMEGIRM
AGTFGLYREATTADVIQEDDGREVPVKAGDRVFVSFVTAAKDPNIFPDPEVVDPRRPLDS
YIHYGVGPHACLGRDISQVALTELFRALFRKKGLRRVAGAQGELKKVPRPGGFFVYMTED
WGSIWPFPTSMKVTWDE
NT seq 3294 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaccaagtaaagaacggcgctgtcgcctcgaatggatatggcaaggaaaaa
tccccttcttcagcttcttcaagccagaagaatgaggttcctgccccgcctcacaacaag
agtgagggtctggtcaagagcatcaaaaagctgcgcctagcttcaaagagacctctccct
acagagatgggtgatggctcgtaccgacaggttgcgacccgtccaggattgaagcaagat
gttcgtcgtcttcgcggaaaagatctcaagacattgctcgagatcatctcaagcaagctc
aagggagagatgcaacaagatgacaagaccatgatcatggagcgaacgatccagctggtt
gcaaatttgagcgatcattccaaagtccaggaggctttgacgaatagcttcattgcgcag
ctctggaactcgattgatcacccacctatgctgtacatgggaaacaagtatcgtttccgc
cagcctgacggatcgtggaacaacccttatcttccccagcttggtgccgctagaacacca
tactcgagaacagtgcgtcccaagggtatgagtttaggtgctcagcctgatccagaggcc
attttcgagtctgtttttgcgcgaggtatcttccgcaagaacccgaacaatgtgtcgagt
atcctctggtactgggccacaatcattatccatgacccagaccaaaacgactcatcttcc
tacctcgaccttgcccctctctacggctcaaccgtgaaagaccgcgactcgatccgaaca
ttcaaggatggccagctcaagcccgattgcttcgctgacaagcgtctcatcggcaaccct
cccggtgttcccatcatcctcatcatgttcaaccgtttccacaatcacgtcgcgactaac
ctcgccgacatcaacgaaggtggtcgcttcagcaagcctggcgctcatctcgacgctgaa
gctgctgctgccgcgtggaagaagcgtgatgaggagctgttcgagaccgccagattggtc
acgagtggattgtacatcaacatcactctcatcgactacgtgcgcaacattatcaacctg
aaccgtgttgacacgacttggactcttgatcctcgccaggagatgggtgtctctgtcggc
accaagaacctttctgagagcggcactggaaacgtggtttcagccgagttcaacctgtgc
taccgctggcactcttgcctgtccgagatggatgagaaatgggttgaggacttctatact
gaacttctcggtgagaactatggccccatgaacctgcagaccatgatgagggctctcaag
gcattcgaggcaacagtcgccgaagagccttccgagcgtacctttggcggcttcaagaga
ggccccgacggcaagttcaacgatgatgagcttgttgaggcactcgctacggcgattgaa
cagcctggtggtgctttcggtggccgtaacgtgccacgtattatgaagcccatcgagatg
ctcggcatcatgcgaggtcgcaagtggaacttggcaggtctgaacgagttccgaaagcac
ttcggtctcaaggcgtacgacacttttgaggacatcaactcagatcctgaagtcgctgat
gccttgcggaacttgtaccaacaccccgactacgtcgaactgtaccccggtatcgtcgca
gaggaggcaaagacgcctatggttcccggtgttggtatcgctcccacgtatacaatctcc
cgagtggtcctctcggatgctgtggctcttgttcgtggtgacaggtactacactattgac
taccatccccgcaacttgaccaactggggttacaaggaggttgactacgacctcaacatc
aaccatggctgcgtcttctataagctcttcctgcgtgcattccctcaacacttcaagggt
aactctgtctacgcccactaccccatggtcatccccacagagaaccacaagattctcacc
gacctgaagcgcgtggatcgtttcgacttcagccgtcctgcacccacagccacacgcatc
aatatcgtgggctacaaggcggctaagtacatcctggaagaccaggccaagtaccgtgtc
tgctgggaggagggcctcaagcacctcatgggcgagggtggtggtcgcttcatgttgtct
ggtgacacagcgttgcacgcacagcagcgcaagtgcatgggtcgtctgctgtacaatgat
acctggcgcaacgcggttaagtcgttctactcgacaacggccgagatgcttctgaatgaa
aagtcgtacacgctcgcgggcaagaagcaggttgatgtcgtgcgtgacgtgggtaacgtt
gcacacacgcactttgtcgcgaggatgttcaaccttcctctcaagacgaagcagaacccc
aagggtgtcttttcggagcaggagctgtacatgatcctggcggttatctttgtttgcatc
ttcttcgacattgatcctgctaagtctttccctctgagacaagccgccagagaggttgca
cagcagctgggtaagattgtggagatgaacgtcaagctggccaccagcgttggcatcaag
ggtctgttcaccagcaagcccaacaagaacgatgacccgcttgctgcgtatggtgagaac
atggccaagggtctcaagaaggctggtctgagcattgatgacatcgtgtggagccagatc
ttgcccaccgctggggctatggtgccgaatcaggctcaggtgtttgcccaaaccttggat
tggtatctttctcctgctggtgagaagtatcgccccgagcttcatcgtattgccgctctg
gagacaggcgacgagacagatgctctgctgcttggttacgcgatggaaggtattcgcatg
gctggaacattcggactgtaccgagaagccacaaccgcggatgtcatccaagaagatgac
ggccgtgaagtacccgtcaaggctggcgacagggtgttcgtttccttcgtcactgctgcc
aaagaccctaacatcttccccgaccccgaggtagtcgatcctcgtcggccgctggactcg
tatatccactatggcgtaggcccacacgcatgtcttggaagggacatcagccaggttgcg
ctgacggagctattcagagccctattcaggaagaagggcctgaggagggtggcgggtgcg
cagggagagctcaagaaggtgcctcgacctggtggtttctttgtgtacatgacggaggac
tggggcagcatttggccgttccctacaagtatgaaggtaacatgggatgagtag

DBGET integrated database retrieval system