KEGG   Fusarium graminearum: FGSG_11164Help
Entry
FGSG_11164        CDS       T01038                                 

Definition
(RefSeq) trypsin precursor
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
fgr  Fusarium graminearum
Brite
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     FGSG_11164
Peptidases [BR:fgr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   FGSG_11164
Exosome [BR:fgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FGSG_11164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3
AA seq 252 aa AA seqDB search
MVKITSLVALAAPLVAAAPNPQNSPQIVGGTSASAGEFPFIVSITNNGGPWCGGTLLNAN
TVMTASHCVQGRSASAFAIRVGSNSRTSGGVTSRVSSIRMHPSFSGSTLNNDVALLKLST
SIPAGGSIAYGRLATSGSDPAAGSSLTVAGWGDTSEGGGVSPVNLLKVTVPVVSRATCRS
QYGTSAITDNMFCAGVTGGGKDACQGDSGGPIVDSSKTVVGIVSWGDGCARPNAAGVYAR
VGTLRSWIDSNA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagatcacttccctcgttgccctcgcggcccctctggttgctgctgctcccaac
cctcagaacagcccccagatcgttggcggaacttctgccagcgctggtgaattccccttc
atcgtcagcatcaccaacaacggtggtccctggtgcggtggtactctcctcaacgccaac
actgtcatgaccgcctcccactgtgtccagggccgatctgccagtgctttcgccatccgt
gtcggatccaactctcgcacctctggcggtgtcacttctcgtgtctctagcatcagaatg
caccctagcttcagcggctctaccctcaacaacgatgttgctctcctgaagctttccact
tccatccctgccggtggctccattgcctacggtcgccttgccacctctggctctgacccc
gctgctggatcttctcttaccgttgctggctggggagacacctctgagggtggtggcgtc
agccccgtcaacctgctcaaggttaccgttcctgttgtctctcgtgctacctgccgatcc
caatacggcacctctgccatcaccgacaacatgttctgtgctggtgtcaccggaggtggt
aaggatgcttgccagggtgacagtggtggtcccattgtcgactcttccaagaccgttgtc
ggtatcgtctcttggggtgacggatgcgcccgacccaacgccgctggtgtctatgctcgc
gtcggtaccctccgatcttggatcgacagcaacgcctaa

DBGET integrated database retrieval system