KEGG   Fervidobacterium islandicum: NA23_04790Help
Entry
NA23_04790        CDS       T04215                                 

Definition
(GenBank) FAD/NAD(P)-binding oxidoreductase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fia  Fervidobacterium islandicum
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fia00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NA23_04790
Enzymes [BR:fia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NA23_04790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1028479..1029921)
Genome map
AA seq 480 aa AA seqDB search
MRVGIIGAGVVGALIAREMSRYDVEVLIFEKNWDVGMGITKANSAIVHAGYDDEPGTVRS
KFCVPGNSLYTELAKELQFDLKRIGSLVLAFKDDEVRVLEELYKRGEINGVPGLEIWDRD
KILSYEPNVNPEVIAALWAPTAGITEPWMVAMAAVENAVENGAKPYLDTQVLEIVTENQK
VKKVVTNKGEFEVDVLINAAGMYGDEVAKMAGAEFVPLHPRKGEYILLDKQEFSGFVKSI
LFPTPSVLGKGTLVTPTVDGGILVGPTAVDLPPEREFREDTSTTFEGFEALISRALKMAP
LIDFRASIKTFAGLRPESPQKDFFIGRTSVTGFFNVIAMRSPGLTAAPAIAKFMVEEVQE
AMGETFHEKGNFKATRERIKHYADLPPSIWNEEIEKDPLAGKMICFCNKVTEREILEAIK
RGARTIDGIKFRTRAMFGSCQGGFCMHRIMKILARELGVDASDIRLRSEGSFILLGKVRK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaggtatcattggtgcaggtgttgttggagccttaattgccagagagatgagt
agatatgatgttgaggttctaatttttgagaagaattgggatgttgggatgggcataaca
aaagctaactctgcgattgtccatgctggatacgatgatgaaccaggaacggttcgctcg
aagttctgtgtcccaggtaactcattgtacacagagcttgcgaaggagctgcagttcgat
ttaaaaagaataggttctttagtgctggcctttaaagatgacgaagtaagagttttggaa
gaactatataagcgcggtgaaataaacggagtaccaggtttagaaatttgggatagagac
aaaatcctttcgtacgaaccaaatgttaatccagaggttatagctgccctttgggcacca
acagccggtataacagaaccttggatggttgctatggcagctgtggaaaacgcagtggaa
aatggagcaaaaccgtatcttgacacgcaagtcttggagatagtaacagaaaaccaaaag
gtcaaaaaggttgtaaccaacaaaggtgaatttgaagtggatgtacttattaacgcagct
ggaatgtacggcgatgaagttgcaaaaatggctggtgcagagttcgtaccgctgcatcca
agaaaaggagaatacatcctgttagataagcaagaattcagtggctttgtaaagagcatt
ctcttcccaacgccttccgttcttggcaagggaacacttgttactcctacggtagatggc
ggaattttggttggcccaaccgccgtcgatttgccacctgaaagagaattcagagaggat
acatcaactacgtttgaaggatttgaggctctgatatccagagcgttgaagatggcacca
ctgattgatttcagagcatcgataaaaacattcgcaggcttaaggccagaaagtcctcaa
aaggatttctttataggtagaaccagtgtgacaggtttctttaatgtgatagccatgcga
tcaccaggtttaactgcagcacctgcaattgcaaagtttatggtcgaagaagttcaggaa
gccatgggcgaaacgtttcatgagaaaggaaatttcaaagctactagagaaaggataaaa
cactacgcagatttgccaccctcgatatggaatgaagaaatcgaaaaagacccgcttgcc
ggaaagatgatatgtttctgcaataaggtaaccgaaagggaaatattggaagccattaaa
cgaggtgcgagaacgatagatggaataaaattcagaactcgcgcaatgttcggtagttgc
caaggaggattctgtatgcacagaataatgaaaatcttagcaagagaactcggagttgat
gcttcggacataagacttcgcagcgaaggtagtttcattctattagggaaggtgagaaaa
tga

DBGET integrated database retrieval system