KEGG   Fibrella sp. ES10-3-2-2: A6C57_00700Help
Entry
A6C57_00700       CDS       T04805                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fib  Fibrella sp. ES10-3-2-2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fib00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A6C57_00700
   00030 Pentose phosphate pathway
    A6C57_00700
   00051 Fructose and mannose metabolism
    A6C57_00700
   00052 Galactose metabolism
    A6C57_00700
  Energy metabolism
   00680 Methane metabolism
    A6C57_00700
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    A6C57_00700
Enzymes [BR:fib01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A6C57_00700
Protein phosphatases and associated proteins [BR:fib01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A6C57_00700
Messenger RNA biogenesis [BR:fib03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     A6C57_00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(130760..131737)
Genome map
AA seq 325 aa AA seqDB search
MKRIAVFTSGGDAPGMNACIRAVVRGAVYHGLEVFGIRRGYNGMINGDIFQMTSHSVSNI
VQRGGTILKSARSKEFMTPEGRQKAYDQLQKFGIEGLVAIGGNGTFTGATLFFDEFGIPT
VGAPGTIDNDLYGTDYTIGFDTAVNTALEAIDKIRDTADSHDRIFLIEVMGRDSGYIAIQ
SGIAGGAELVMVPEVLTPISEVVNILQQGFTRSKSSSILVVAEGEEEGSAKEVAAKISQM
MVGQDLDMRVTTLGHIQRGGVPTAYDRILASRLGLGALEGLMNGEKNVMAGVINNELVYT
PFRDTIRLPKPINEDLLRMVKILSV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgtgtttacctccgggggtgatgcgccgggtatgaacgcctgtatc
cgggcggttgtgcgcggggccgtttaccacggtcttgaagtatttggcattcgccggggg
tataatggaatgattaatggcgacatattccagatgacttcgcactcggtgagcaatatt
gttcagcgaggtggtactattctgaagtcggctcgcagcaaggagttcatgacccccgaa
gggcggcagaaagcctatgaccagttgcaaaaatttggtatcgaagggctggtcgccatc
ggcggtaacggtacgtttaccggcgctaccctcttcttcgatgagtttggtattccaaca
gtgggggcccccggaaccattgataatgacctctacggcaccgactacaccattggcttc
gatacggcagtaaatacggccctggaagcgatcgataaaattcgcgatacggccgattca
cacgaccggatcttcctgatcgaagtaatggggcgtgactcaggttatatcgccattcag
tcgggtattgccggcggtgccgaactggtcatggtgcccgaggtactaacgccgatctct
gaagtggtgaatattctgcaacagggctttacccgcagcaaatcatcgtctatcctggtc
gtagctgaaggcgaagaagaaggcagcgcaaaagaagtggccgcaaagatcagccagatg
atggttgggcaagacctggacatgcgcgtaactacactgggccatattcagcgtgggggc
gtacccacggcctacgaccgcattctggccagccgcctgggacttggagctcttgaaggc
cttatgaatggtgaaaagaacgtaatggcaggggtgatcaacaatgaactggtctacacg
ccgttccgcgatacgattcggttgcccaaaccaattaatgaagacttactcaggatggtg
aaaatcctgtcagtatag

DBGET integrated database retrieval system