KEGG   Fibrella sp. ES10-3-2-2: A6C57_04175Help
Entry
A6C57_04175       CDS       T04805                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fib  Fibrella sp. ES10-3-2-2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fib00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6C57_04175
  Amino acid metabolism
   00310 Lysine degradation
    A6C57_04175
   00380 Tryptophan metabolism
    A6C57_04175
Enzymes [BR:fib01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     A6C57_04175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(981368..984145)
Genome map
AA seq 925 aa AA seqDB search
MDQYSYVANSDAAYIDQLYQSYKQDPASVDTSWQQFFKGFDFSLAYGEKGESANGNGATT
NGTAQTVPVDARHSEKEVSVASLIKAYRSRGHLLSKTNPIGPRKDRNPRLGLADYALTEA
DLDTVFESGNLLGIGAATLRKIMESLETIYAGRIGFEYMYIREIDVKNWLRNKIEKEALT
FSPTPAEKKRILEKLNEASIFENFLHTKYLGQKRFSLEGGETTIAALDAIISRAADMGVE
EVMIGMAHRGRLNVLTNILGKSYEAIFDGFEGSVPTQVHGDGDVKYHLGYTSLTKTPSGK
EISVKLAPNPSHLEAVNPVVEGFVRAQADEEYKGDFSKIMPILIHGDAAVAGQGVVYEVT
QMAKLPGYQTGGTLHFVINNQVGFTTDFEDARSSIYCSDVAKIIDAPIFHVNGDDPEAVI
FCAKLAVEFREMFKRDVFIDMVCYRRYGHNESDEPKFTQPTMYSAIEKHNNPRELYSKLL
IERGDLDADLAAKMDAEFKKVLQDRLDQVKQKPGLPYKPLRLDQQWAELRYAEPADFDQS
PQTGVPIETLEKIGKALATIPEGFKPLKQIDKLLADRQKMVFDTRMVNWSVAEQMAYGSI
LLENKVVRLSGQDVQRGTFSHRHAVLHDSTNNKLYTPLNHIQEGQLPVQIFNSHLSEFGV
LGFEYGYAMAAPHALVIWEAQFGDFANGAQVIIDQFVTAGESKWGIQNSLVMQLPHGYEG
QGPEHSNARPERFLQLCAENNLVVANITTPANIFHALRRQLAWEFRKPLVIMSPKSLLRH
PQAISSLDELASGTFREVIGDSFADPKKVKRVLLCTGKVYYDLLDKQQADKRDDVAIIRM
EQLYPLPMKQLDAELAKYKKSEIVWVQEEPENMGCFSFMLRRFRDRFTGAQSLRYVGRES
ASSPATGFAKLHTQEQAALVQKAFE
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtattcatatgtagccaactctgatgcggcttatatcgaccagctttatcag
tcgtataagcaggaccccgcatcggtagatacgagttggcagcagttttttaaagggttt
gacttttcgcttgcctatggcgaaaagggtgaatcggccaatggaaatggagccactacc
aatggtacagcccagacagttcccgttgatgccagacacagtgagaaagaagtatcggta
gccagcctcatcaaggcttaccggtcgagaggacacctgctgtcgaaaacaaacccaatt
ggtccccgtaaagatcgtaatccgcgcctcggtctggccgattacgcgctgacggaagcc
gacctggacacggtgttcgagtcgggtaacctgctgggtattggtgcggcaacgctccga
aaaattatggaatcgctggaaaccatctacgcgggccgcattggcttcgagtatatgtac
atccgcgaaattgatgtaaagaactggttacggaacaaaatcgagaaagaagcgctcacc
tttagcccaacgcccgccgagaagaagcggattctggagaagctgaatgaggcctcgatc
ttcgaaaacttcctgcacacaaaatacctcggtcagaaacgcttctcgctcgaaggtggc
gaaacgactattgctgccctggacgctatcatcagccgcgcggccgatatgggcgttgaa
gaagtaatgataggcatggcccaccgcggacgtcttaacgtgctgaccaacattctggga
aaatcgtacgaagcgatcttcgacgggtttgaaggaagcgtacccacgcaggtgcatggt
gacggtgacgtaaaataccaccttggctacaccagcctgaccaaaacaccaagcggcaag
gaaatcagcgtgaagctggcccccaacccgtcgcacctcgaagcggtgaaccccgtagtt
gaagggtttgttcgcgctcaggccgatgaggagtacaagggtgacttctcgaaaattatg
ccgatcctgattcatggcgacgccgccgtagcgggtcagggtgtagtgtatgaagtaacg
caaatggcgaaactgcccggttaccagactggcggtacgttgcactttgtgatcaacaac
caggttggtttcaccactgactttgaagatgcccgttcgtcgatctattgctcagacgta
gcgaagattatcgacgcgccgattttccacgtcaacggcgatgacccggaggcggtgatc
ttctgcgctaagctggccgtggaattccgtgagatgttcaagcgcgacgtgtttatcgac
atggtgtgttaccgtcgctacggccacaacgagtcagacgagccgaaattcacgcagccg
accatgtactcggcgattgagaagcacaacaatcctcgcgagctctacagcaaattgctg
atcgagcggggtgatcttgatgctgacctcgccgccaagatggacgctgagttcaagaaa
gtactacaggatcgcctcgatcaggtgaagcagaagccgggtcttccttacaagccgctt
cggctcgatcagcagtgggctgaactgcgttacgccgaaccagccgacttcgatcagtca
ccccagacgggcgtgccgatcgagacactggaaaaaatcggtaaggcgctggccacgatt
ccggaaggattcaagccactgaagcaaatcgacaagctgctggccgaccgtcagaagatg
gtattcgacacgcggatggtgaactggtcggtggccgagcaaatggcctatggctctatc
ctgctcgaaaacaaagtagttcgcctcagtggccaggatgtgcagcggggtacgttctcg
caccgtcatgccgtactgcacgattcgaccaacaacaaactatacacaccgctcaaccac
attcaggaagggcagttgcctgtacagattttcaactcgcacctgtctgaattcggggtg
ttgggttttgagtatgggtatgccatggcggcaccacacgcgctggtgatctgggaagca
cagtttggtgattttgccaacggtgcgcaggttatcatcgaccagtttgttacggcgggt
gaatcgaaatggggcattcagaacagcctggtcatgcagttgccacatgggtacgaaggt
cagggtcccgagcactcgaatgcccgtccagagcgcttccttcaattgtgtgccgagaat
aacctggttgtggcgaatatcaccacgccggccaatattttccacgcgcttcgtcgtcag
ctggcctgggagttccgcaagccgctggtgattatgtcgcctaaatcgctgctacgtcac
ccgcaggctatctcgtcgctcgacgaattggcgtcaggtacgttccgtgaagtaattggt
gattcatttgccgacccgaaaaaggtgaagcgtgtgttactttgcacgggcaaggtgtat
tatgacctgctggataagcaacaggccgataagcgcgacgacgtagccattatccggatg
gagcagctgtatccgttgccaatgaagcaactcgacgctgagttggcgaaatacaagaag
tcggagattgtgtgggtgcaggaggagcccgaaaatatgggttgcttctcgttcatgctt
cgccgcttccgcgaccggttcaccggggcacagtcgctccggtacgttggtcgcgagtcg
gcttcttcacctgccaccgggtttgccaaacttcacacgcaggagcaggcagcattggtt
cagaaagcatttgaataa

DBGET integrated database retrieval system