KEGG   Flavobacterium johnsoniae GSE09: BB050_03717Help
Entry
BB050_03717       CDS       T04718                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fjg  Flavobacterium johnsoniae GSE09
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fjg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BB050_03717 (ppc)
  Energy metabolism
   00680 Methane metabolism
    BB050_03717 (ppc)
Enzymes [BR:fjg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BB050_03717 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4364545..4367130
Genome map
AA seq 861 aa AA seqDB search
MYTLPKIERFNQDVLSKYHIYNSVFITLPFDSIDNTGVLLPLFTETCETGFKKQETPKEI
VDFFSNKYLNNASEEEKIDLMFRFIQYIERQIVLFDAIEDAAFPEVNNMEGRGSLRDIKE
KSDAKEKDEELSEFLESFNVRTVLTAHPTQFYPGPVLGIINDLTEAIRQNDLLKIKQLLA
QLGKTPFIQKEKPNPYDEAVSLIWYLENVFYATAGEIVHYLQKNILEGNPIHNQLIKLGF
WPGGDRDGNPFVTTDITLKVADRLRTSILKCYYVEMRNLKRKLTFSGVDDLVAELEHKLY
RSVFYSKGDIFITLDELLTQLNKIRAIIIEKHQSLYLDELDALLVKINLFGFHFATLDIR
QNSKIHNAVFKDVVNYYLNSGSDIFPKNYFELTEDQKINVLSKVKGKLNPADFENEITRY
TLESVQAIKTIQQNNGEEGANRYIISNNESALNVMETFAMIRLNDWEKPTVDIIPLFESV
DDLQNAHTIMEQLYTNPEYAKHLKSRGNKQTIMLGFSDGTKDGGYLMANWSIYQAKISLT
KISREYGIKAIFFDGRGGPPARGGGKTHKFYASLGPKIENNEIQITVQGQTISSNFGTLD
SCRYNIENLLSAGVTNQVFSKEKNELTAEETQILTDLANLGYDKYLSFKNHPKFIPYLEK
MSTLKYYSKTNIGSRPSKRSKSESLDFADLRAIPFVGSWSQLKQNVPGFFGVGSALKHFE
ETGQWNKVSDLYHNSLFFKTLLENSMMSLAKSFLPLTAYMKNDPEFGEFWQIIYDEFSET
KRLLLKIAGHKTLMENYPDGIASIQIRERIVLPLLTIQQYALLRINELNKAETPNEELVK
VYEKIVTRSLFGNTNASRNSA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgtatacgttgccaaaaattgagcgttttaatcaagacgttctctcaaaataccacatt
tataatagtgtttttataacattaccctttgattctatagataatactggagttttactt
cctttatttacagaaacttgcgaaacgggctttaaaaaacaagaaacaccaaaagaaatt
gttgatttcttctcaaataaatatttgaataacgcttctgaagaggaaaaaatcgatctt
atgtttcgatttattcaatatattgaacgccagattgtattgtttgatgctattgaagac
gcagcttttccagaagttaacaacatggagggacgcgggtctcttcgcgacatcaaagaa
aaatcggacgctaaagaaaaggatgaagaattaagcgaatttctagaaagttttaatgtt
cgtaccgttctaacagcgcatccaactcagttttatcctggtccagttttaggaattata
aatgatttgacagaagcaattcgtcaaaatgatttgctgaaaattaaacaattactggct
cagcttggaaaaacgcctttcattcaaaaagaaaaaccaaatccttacgatgaggcggta
agtttaatttggtaccttgaaaatgtattttatgcaactgcaggagaaattgtgcattac
ctgcaaaaaaatattttagaaggaaacccaattcacaaccaattaatcaaacttggtttc
tggccaggaggtgaccgtgatggaaatcctttcgttactacagatattacacttaaagtg
gcagatcgtttacgtacctcaattttaaagtgttattatgtagaaatgagaaatctaaag
cgcaagctaactttctcaggagtagatgatttagtagcagaacttgaacataaactttac
cgttctgtattttattctaaaggagatatttttatcactttagacgaattactaacacag
ctgaataaaattagagctataattattgagaaacatcaatctttatatttagacgagtta
gatgcgcttttggtaaaaataaatttgttcggattccattttgcgactttagatattcgt
caaaacagtaaaattcataatgcagttttcaaagatgttgtcaattattatttgaattct
ggctcagatatttttcctaaaaattatttcgaattgacggaagatcaaaaaatcaatgtt
ttatcgaaagttaaaggaaaacttaatccagcggattttgaaaatgaaattactagatat
actttagaatctgttcaggctattaaaacaattcagcaaaataatggagaagaaggagca
aaccgttatatcattagtaataacgaaagtgccctgaatgttatggagacttttgccatg
attcgtttgaatgattgggaaaaaccaactgtagatattattccgctttttgagtctgta
gacgatttgcaaaatgcgcatactattatggagcaattgtacaccaatccagaatatgca
aaacatttgaaatcgagaggaaacaaacagactatcatgcttggattctcggacggaact
aaagatggcgggtacttaatggcaaactggagtatttaccaagccaaaatttcgttgact
aaaatttctagagaatacggaattaaagcgattttctttgatggacgtggcggacctcca
gcgcgtggcggtggaaaaacacataaattttacgcttctcttggtccaaaaattgaaaac
aacgaaattcaaattacagttcaaggtcaaacgatcagctctaattttggaactttagat
tcttgccgttataatattgaaaacttattgagtgctggtgttacaaaccaagtatttagt
aaagagaaaaatgaattgacagcagaagaaactcaaatcttaactgatttggctaatttg
ggttatgataaatatttaagcttcaaaaatcatccgaagtttattccgtacttggaaaaa
atgagtactctgaaatattactcaaaaactaatattggaagccgtccttcaaaaagaagc
aaatctgagtcattggattttgctgatttaagagcaattccatttgtgggttcatggagc
cagttaaagcaaaacgttccaggattctttggagtgggttctgctttaaaacattttgag
gaaactggacaatggaataaagtaagtgatttgtatcataattctttatttttcaaaaca
ttgcttgaaaatagtatgatgtcattagcaaaatcatttttaccattgacagcttatatg
aaaaatgatcctgagtttggtgaattctggcagattatctatgatgaattctcagaaaca
aaacgccttttattgaaaattgctgggcataaaacattgatggaaaattatcctgatggt
attgcttcaattcagattagagagcgcattgttttaccgttattaactattcagcaatat
gctttattgagaatcaacgaattaaacaaagcagaaactccaaatgaagaattggtgaaa
gtttatgagaaaatcgtaacaagatcattatttggtaatacgaacgcaagtagaaactca
gcttaa

DBGET integrated database retrieval system