KEGG   Flavobacterium johnsoniae UW101: Fjoh_1948Help
Entry
Fjoh_1948         CDS       T00508                                 

Definition
(GenBank) Candidate alpha amylase; Glycoside hydrolase family 13
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Fjoh_1948
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Fjoh_1948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2255093..2256532)
Genome map
AA seq 479 aa AA seqDB search
MKKPIARLCFVMALTGLLYSCSQNETNDVDSKAESQQFKIINVTHHDGKPFSTGKSSSLT
GKYVDNPGGGVMMQAFYWDVPAGGTWWDTVKGKVTAWGNAGIGSIWLPPASKAQNGAFSM
GYDPTDYFDFGDYNQNGSTETRFGSKAELVSLITAAHNENIKVYADIVINHNSGGQSEAN
PFTGTNTWTNFTGVASGKFPRNYNDFYKNSYGNNDEGSFGGFPDLCHAAPNVQNWLWLRA
DGVGKYYKNTMKFDGWRFDYVKGFGAWVVNAWNSNVGGFSVGELWDSNVNVLNDWANNAN
SSVFDFACYYKMNDAFDGNNLALLNDDMMWKRNPYKAVTFVTNHDTDEIWSKMLAYSYIL
THEGYPTIFYRDYEEWLDKNKLNNLIWIHNNKATGTTSILYSDNDEYVARRNGYNGNPGL
VVYINNSDSWQERWIQTNWANTQIKDFTGNSSWYPTTQADKWVKIQCPPRGYSIWSINQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctattgcaagattgtgttttgttatggcacttacaggattgttgtactct
tgttcgcaaaacgaaacaaacgatgttgattcaaaagcagaaagtcagcagtttaaaatc
attaatgtcacgcatcacgacggaaagcctttcagtacaggaaaatcttcttctctaact
ggaaaatatgttgataacccaggtggaggtgttatgatgcaggccttttattgggatgta
cccgctggaggaacttggtgggatactgtaaaaggaaaagtaactgcttggggaaatgcc
ggaattggttctatttggctcccacctgcttcaaaagctcaaaatggagcattctctatg
ggatatgatcctactgattattttgattttggagattataatcaaaacggaagcactgaa
acacgatttggatcaaaagctgaattagtaagtttaattacagctgcccataatgagaat
atcaaagtttatgcagatatcgtaatcaatcataacagcggcggacaatctgaagcaaat
ccatttacaggaacaaatacctggactaattttacaggagttgcttcgggtaaattccct
cgtaactataatgatttttataaaaacagttacggaaataatgacgaaggttcttttgga
gggtttcctgatttatgccacgctgcacctaacgttcagaactggctgtggctgcgtgct
gacggagttggtaaatattataaaaacacaatgaagtttgacggctggagattcgactat
gtaaaaggctttggtgcatgggttgtaaatgcatggaattcgaatgttggaggattttct
gttggagaattatgggattcgaatgtaaatgtattaaatgactgggcaaacaatgcgaat
agttctgtatttgattttgcatgttattataaaatgaacgatgcctttgacggaaataat
ctggcattattaaatgatgatatgatgtggaaacgcaatccgtacaaagcagtaactttt
gtaaccaatcatgatactgacgaaatctggagcaaaatgttagcttactcctatatatta
actcacgaaggttatccaacaattttttatagagattatgaagaatggttagacaagaac
aaacttaataatctaatctggattcacaacaataaagcaactggaacaacttctatttta
tattcagacaatgatgaatatgttgccagaagaaacggatacaacggaaatcccggattg
gttgtttacataaacaattctgactcgtggcaggaaagatggattcaaaccaattgggca
aatactcaaattaaagattttacaggaaactcatcttggtatccaactactcaagctgac
aaatgggtaaaaatacaatgtcctccaagaggatattcaatttggtcaattaatcagtaa

DBGET integrated database retrieval system