KEGG   Fomitiporia mediterranea: FOMMEDRAFT_23324Help
Entry
FOMMEDRAFT_23324  CDS       T03132                                 

Definition
(RefSeq) glutathione-S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fme  Fomitiporia mediterranea
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fme00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FOMMEDRAFT_23324
Enzymes [BR:fme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FOMMEDRAFT_23324
Transporters [BR:fme02000]
 Other Transporters
  Pores ion channels [TC:1]
   FOMMEDRAFT_23324
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 256 aa AA seqDB search
MSIPDQHIHPSATGEAAKVVAAHQAPEEVVFYSGWFCPYVQRTWIALEEKGIPYQYKEVN
PYKKEKHFLDINPKGLVPALEYRGKALYESLILCEFLEDLYPNNPPYLLPHDPYDRAFVR
IWVDHISKRVIPAFMRLLQSQEREKQDEARKDLYEGLRQLSEKCKGPYFLGAELSLVDVA
IAPWVVREYVITENRGYKRSEVSDAWNEWAGLLEKRESVVRTTSERAYYAEIYGRYLRDE
AQSEAAKATRAGRIIP
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtctattccagatcagcatatccatccaagtgcgactggtgaggctgcgaaagtagta
gcggcgcaccaggctcctgaagaggttgtgttctacagtggatggttctgtccttacgtg
caacgaacgtggatcgctcttgaggagaaaggcattccataccaatataaggaggtcaat
ccgtacaagaaagaaaagcacttcctagacattaacccgaagggtcttgtcccagctctt
gaatatcgagggaaggcactctacgaatcactcatcctatgcgagttcctcgaagacctc
tatccaaacaacccaccctaccttctcccacacgacccatacgatcgggcgttcgttcgc
atctgggtggaccatattagtaagcgtgtaatcccggcgttcatgcgtctcttgcagtcc
caggagcgtgagaagcaggacgaggcgagaaaggatttgtatgaaggtttgagacagctt
tctgagaaatgcaaagggccgtatttccttggtgcggagttgagcttggtggatgtggca
attgcaccgtgggttgtgagggagtatgttatcactgaaaatcgtggatacaagaggagt
gaagtttcggatgcgtggaacgagtgggcaggtttgttggagaagagggagagtgtagta
aggacgaccagtgaacgagcgtattatgcggagatttatggacggtaccttcgggacgaa
gcgcaaagtgaggcagcaaaagctaccagggcaggaagaatcattccttaa

DBGET integrated database retrieval system