KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN1555Help
Entry
FN1555            CDS       T00077                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Brite
Translation factors [BR:fnu03012]
 Eukaryotic Type
  Elongation factors
   FN1555 (tuf)
 Prokaryotic Type
   FN1555 (tuf)
Mitochondrial biogenesis [BR:fnu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    FN1555 (tuf)
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   FN1555 (tuf)
  Exosomal proteins of breast cancer cells
   FN1555 (tuf)
  Exosomal proteins of colorectal cancer cells
   FN1555 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(76342..77526)
Genome map
AA seq 394 aa AA seqDB search
MAKEKYERSKPHVNIGTIGHVDHGKTTTTAAISKVLSDKGWASKVDFDQIDAAPEEKERG
ITINTAHIEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVYLNKSDMVEDEELLELVEMEVRELLTEYGFPGDDIPVIRGSSLGALN
GEEKWVEKILELMEAVDNYIPTPERAVDQPFLMPIEDVFTITGRGTVVTGRVERGVIKVG
EEIEIVGIKPTTKTTCTGVEMFRKLLDQGQAGDNIGVLLRGTKKEEVERGQVLAKPGSIH
PHTNFKGEVYVLTKDEGGRHTPFFTGYRPQFYFRTTDITGAVTLPDGVEMVMPGDNITMT
VELIHPIAMEQGLRFAIREGGRTVASGVVSEITK
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaatatgaaagaagtaaaccacatgtaaacattggaacaatcgggcac
gttgaccacggaaaaacaactacaactgctgctatatctaaagtattatctgataaagga
tgggctagcaaagtagatttcgaccaaattgatgctgctcctgaagaaaaagaaagagga
ataactattaacacagctcatattgaatatgaaacagaaaagagacactatgctcacgtt
gactgtccaggacacgcggactatgttaaaaatatgataactggagctgctcaaatggac
ggagctatacttgttgtatcagctgctgatggtcctatgcctcaaacaagagaacatatc
ttactttctagacaagttggagttccatatatagttgtttatttaaacaaatcagatatg
gttgaagatgaagaattattagaattagttgaaatggaagttagagaattattaactgaa
tatggattcccaggagatgacatccctgtaatcagaggttcatctttaggagctttaaat
ggtgaagaaaaatgggttgaaaaaatattagaacttatggaagcagtagataactatatc
cctactccagaaagagcagtagatcaaccattcttgatgccaatagaagacgttttcact
attacaggaagaggaacagttgttactggaagagttgaaagaggagttatcaaagttgga
gaagaaattgaaatagttggaattaaacctacaactaaaacaacttgtacaggtgttgaa
atgtttagaaaacttcttgatcaaggtcaagcaggagataacattggagtattattaaga
ggaactaagaaagaagaagttgaaagaggacaagttcttgctaaaccaggaagtatccat
cctcatacaaactttaaaggagaagtttatgtattaactaaagatgaaggaggaagacat
actccattcttcacaggatacagacctcaattctattttagaactactgacatcactggt
gcagtaactctacctgatggagtagaaatggttatgccaggagataacatcactatgaca
gtagaattaattcacccaatcgctatggaacaaggattaagattcgctatcagagaaggt
ggaagaacagttgcttctggagttgtttctgaaataactaaatag

DBGET integrated database retrieval system