KEGG   Fusarium oxysporum: FOXG_08140Help
Entry
FOXG_08140        CDS       T04882                                 

Definition
(RefSeq) CMGC/MAPK protein kinase
Organism
fox  Fusarium oxysporum
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Seadorna_VP7 Gag_p6
Motif
Other DBs
NCBI-GeneID: 28949788
NCBI-ProteinID: XP_018244117
UniProt: A0A0C4DHU3
LinkDB All DBs
Position
4
AA seq 355 aa AA seqDB search
MSRSNPPNAAGSRKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDHS
MFCLRTLREMKLLRYFNHENIISILDIQKPRNYESFNEVYLIQELMETDMHRVIRTQDLS
DDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSG
FMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILD
VLGTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPKTSDLALDLLEKLLAFNPVKRI
TVEEALKHPYLEPYHDPEDEPTAPPIPEEFFDFDKHKDNLSKEQLKQLIYQEIMR
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgatcgaacccccctaacgctgcggggtctcgcaagatctcgttcaacgtgagc
gagcagtatgatattcaggatgttgttggcgagggcgcctatggtgttgtctgctctgcc
attcacaagccctccggccaaaaggtcgctatcaagaagatcactcctttcgatcactcc
atgttctgtctaagaaccctgcgagagatgaagctgttgcgatatttcaaccacgagaac
atcatctccattctcgatatccagaagccccgaaactacgagtcatttaatgaagtctac
ttgatccaggagctgatggagacggatatgcaccgagtcatccgcacccaggacctttct
gacgaccactgccagtacttcatctaccagaccctccgcgccctcaaggccatgcactca
gccaacgtgctgcaccgagacttgaagccctccaacctcctcctcaacgccaactgtgat
ctcaaggtttgcgattttggtcttgcgcgatccgctgcttcccaggaggacaactccggt
ttcatgactgaatacgtcgcgactcgatggtaccgtgcgcccgagatcatgttgactttc
aaggagtacaccaaggctattgatgtgtggtcggttggctgcattctcgccgagatgctc
agcggcaagcctcttttccctggcaaggactaccaccaccagttgacactcattctggat
gtgctgggcacgccgactatggaggattactacggaatcaagtcgcgccgcgctagagaa
tacattcgatcgctccccttcaagaagaaggttcccttccgaactctattccccaagacc
tcggatctggccctcgacctgctcgagaagctcctcgcattcaaccctgttaagcgcatt
accgtggaggaagctctgaagcacccataccttgagccttaccacgatcccgaggatgag
ccaacagcgcccccgatccctgaggagttctttgactttgacaagcacaaagacaacctg
agcaaggagcagctgaagcagttgatctaccaggagattatgaggtaa

DBGET integrated database retrieval system