KEGG   Fusarium oxysporum: FOXG_10072Help
Entry
FOXG_10072        CDS       T04882                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fox  Fusarium oxysporum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fox00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    FOXG_10072
Enzymes [BR:fox01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FOXG_10072
Transporters [BR:fox02000]
 Other Transporters
  Pores ion channels [TC:1]
   FOXG_10072
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
11
AA seq 220 aa AA seqDB search
MAEMKPIKVLGVHGPNAGKIILLCEELGLPYETEIIPLTDVKNPNYVAINPNGRLPSIQD
PNTNLTLWESGAIIEYLTETYDKDHKLSFTSGTAEAYHARQWLFFQTTGQGPYYGQAMWF
IIYQPLPEARERYVKEVNRVTSVLEGHLAKQKPDADGNVWFLGGRLSYVDVAFFTWQHTA
EPRIPDEEFNQDDYPHVKKWAENMLKRPSVQKVLKLQEAK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatgaagccgatcaaagtgctgggagtccacggacccaatgctggcaagatt
attctcctctgtgaagaattgggactcccttatgagacggaaatcatccctcttaccgac
gtcaagaacccaaactacgtcgctatcaaccccaacgggcgattgccatctatccaggac
ccaaacacgaacctcactctctgggaatcaggtgccatcatcgagtacctaaccgaaact
tatgacaaggaccacaagcttagcttcacgtctggcacagctgaagcctaccacgctcgc
caatggcttttcttccagacgaccggccagggaccgtattacggccaggcgatgtggttc
atcatctatcagccacttcccgaagctcgcgagcgctatgtcaaagaggtcaaccgtgtg
accagcgttctggaaggacatctggctaagcagaagcctgacgcggatgggaacgtttgg
tttctaggtggtcggctctcgtatgtggatgtcgcgttcttcacctggcagcatacggct
gaaccgcgaattccggacgaggagtttaatcaggatgattacccgcatgttaagaagtgg
gcggagaacatgcttaagcgcccgagtgtgcagaaggtcttgaagctacaggaggctaag
tag

DBGET integrated database retrieval system