KEGG   Fusarium oxysporum: FOXG_10263Help
Entry
FOXG_10263        CDS       T04882                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific dim-5
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
fox  Fusarium oxysporum
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fox00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    FOXG_10263
Enzymes [BR:fox01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     FOXG_10263
Chromosome [BR:fox03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     FOXG_10263
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    FOXG_10263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 344 aa AA seqDB search
MATMLKATERHFYFHGKEGYEVERNNCHWCQIRAFPTHSTLPVTVVNEEDNEVLPDDFRF
INNVVLGKGVEQAGDSFRSGCSCAKDSECQYTSCHCLADLEDDDSSDEEGFDAFGDKIER
ATPKPRRIAYAYHSHGAKAGLLRSKFHNSKMPIYECHQSCSCSIDCPNRVVERGRTIPLE
IFRTPDRGWGVRSPVSIKKGQFVDRYLGEIITSNEADRRRSQSAISQRKDVYLFALDKFT
DSESFDHRLKGPSLEVDGEFMSGPTRFVNHSCDPNMRIFARVGDHADKHIHDLALFAIKD
IPEGEELTFDYVDGVSHEGEETGGDIDHMTRCLCGSKKCRKFLW
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggctacgatgctaaaggccacagaacgccatttctacttccacggtaaagagggctat
gaagtagagcgcaataattgtcactggtgtcagattcgcgcttttccgactcattcaaca
ctcccagtgacagttgttaacgaagaagacaatgaggtacttcctgatgactttagattc
ataaacaacgtcgtccttggtaaaggagttgagcaagctggtgatagcttccgcagcggc
tgctcctgcgccaaggactcagagtgccaatacacgagttgtcactgtctcgccgattta
gaagacgacgattccagcgatgaagagggatttgatgcctttggggacaagatagagaga
gccacaccaaaacctcggagaatagcatatgcataccactcccacggcgcaaaggccggt
cttttacggtccaagttccataactcaaagatgcctatctacgagtgtcaccaaagctgc
tcctgtagtatagactgcccaaaccgcgtcgtcgagcgtggcagaacgattcctttggag
atattccgcacaccagaccgcggatggggagttagatctcccgtgtcaattaagaaaggc
cagttcgtcgaccgatatctcggtgagatcatcacgtccaatgaagcagatcgacggcgc
tcacagtctgctatctctcaacgcaaggatgtttacctatttgctctcgacaaattcaca
gactccgagtcgtttgaccatcggttaaaaggcccatcccttgaagtagacggtgaattc
atgtctggcccgacgcgattcgtcaatcattcatgcgaccccaacatgcgaatctttgcg
cgcgtgggtgatcatgctgacaagcatattcacgatcttgccttgttcgcaatcaaggac
atacctgagggtgaggagcttacatttgactatgttgatggggtttcacacgagggagaa
gaaacgggtggcgacatcgatcatatgactcgttgtctatgcggaagcaagaagtgcagg
aagttcttgtggtga

DBGET integrated database retrieval system