KEGG   Falco peregrinus (peregrine falcon): 101912815Help
Entry
101912815         CDS       T02856                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101912815 (SUV39H2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101912815 (SUV39H2)
Chromosome [BR:fpg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101912815 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101912815 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 407 aa AA seqDB search
MEGWRGAWYVPCLASLETLQELCRKENLRCKSIGITNRSLKSYEVEYLCDYKVEEGTEYY
LVKWKGWPESSNTWEPQKNLKCPVLLQNFLSDKNEYLSRVREGKGLKVRNHGKVLKPAVA
EYIVKKAKQRIALQRWKEDLNRKKNHKAMILVENTVDLEGPPLDFYYINEYKPAPGINVI
NGITTGCECMDCPAEKCCPKEAGFILAYNKHKKLKIQPGLPIYECNSFCRCGPDCPNRIV
QKGTPYSLCIFRTNNGRGWGVKTLQKIKTNSFVMEYVGEVITSEEAERRGQLYDNQGNTY
LFDLDYDSDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRIALFSTRTIKA
GEELTFDYQMKGSIDLTSDSADGLSPSRKRIRTVCKCGAVCCRGYLN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggagggctggcgaggagcttggtatgtgccatgtctagcttcacttgagaccctccaa
gaattatgtaggaaggaaaatctcagatgtaaatccattggaatcaccaacaggagtcta
aagagttatgaggtggaatatttgtgtgactacaaggtagaagagggcacagaatactat
cttgtgaaatggaaagggtggccggaatcttcaaatacttgggaaccccagaaaaatctg
aaatgcccagtgcttcttcaaaactttcttagtgacaaaaatgagtacttgtctcgggtg
agagaaggcaaaggactgaaagtgagaaaccatggtaaagttttgaaacctgcagttgca
gagtacattgtaaagaaggctaagcaaagaatagctctgcagagatggaaagaagatctc
aacaggaagaagaatcataaagcaatgattctggtagaaaacactgtggatcttgaaggc
ccccctttagacttctactacattaacgagtataaacctgctccaggaataaatgtaata
aatggaataacaactggctgtgaatgcatggactgccctgctgagaagtgctgtccaaag
gaggctggatttattttggcttacaataaacataagaagttgaaaatccagcctggcttg
cccatctatgaatgcaattcgttttgtaggtgtgggcctgattgccctaataggatagta
cagaaaggtacaccatattctctttgcatcttcagaactaacaatggccgtggttgggga
gtaaaaacactccagaaaattaaaaccaacagttttgtgatggagtatgtcggagaggtg
attacaagtgaggaagcagagagacgaggccagctgtatgataaccagggaaatacatac
ttgtttgatttggactatgactcagatgaatttacagtagatgcagctcgatatggaaat
gtgtcccactttgtgaatcacagttgtgatccaaatcttcaagtcttcaatgtgtttatt
gataacctcgacttgcgtcttcctcgaatagcgctgttttctacacgaaccatcaaggct
ggagaagagctaacctttgactatcagatgaaaggttcaatagatctgacttcagactct
gctgatggtcttagcccatccagaaagaggatcagaactgtgtgtaaatgcggagctgtg
tgttgcagaggttacctcaactga

DBGET integrated database retrieval system