KEGG   Falco peregrinus (peregrine falcon): 101912815Help
Entry
101912815         CDS       T02856                                 

Gene name
SUV39H2
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101912815 (SUV39H2)
Enzymes [BR:fpg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101912815 (SUV39H2)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101912815 (SUV39H2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101912815 (SUV39H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 101912815
NCBI-ProteinID: XP_005240224
LinkDB All DBs
Position
Un
AA seq 407 aa AA seqDB search
MEGWRGAWYVPCLASLETLQELCRKENLRCKSIGITNRSLKSYEVEYLCDYKVEEGTEYY
LVKWKGWPESSNTWEPQKNLKCPVLLQNFLSDKNEYLSRVREGKGLKVRNHGKVLKPAVA
EYIVKKAKQRIALQRWKEDLNRKKNHKAMILVENTVDLEGPPLDFYYINEYKPAPGINVI
NGITTGCECMDCPAEKCCPKEAGFILAYNKHKKLKIQPGLPIYECNSFCRCGPDCPNRIV
QKGTPYSLCIFRTNNGRGWGVKTLQKIKTNSFVMEYVGEVITSEEAERRGQLYDNQGNTY
LFDLDYDSDEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDLRLPRIALFSTRTIKA
GEELTFDYQMKGSIDLTSDSADGLSPSRKRIRTVCKCGAVCCRGYLN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggagggctggcgaggagcttggtatgtgccatgtctagcttcacttgagaccctccaa
gaattatgtaggaaggaaaatctcagatgtaaatccattggaatcaccaacaggagtcta
aagagttatgaggtggaatatttgtgtgactacaaggtagaagagggcacagaatactat
cttgtgaaatggaaagggtggccggaatcttcaaatacttgggaaccccagaaaaatctg
aaatgcccagtgcttcttcaaaactttcttagtgacaaaaatgagtacttgtctcgggtg
agagaaggcaaaggactgaaagtgagaaaccatggtaaagttttgaaacctgcagttgca
gagtacattgtaaagaaggctaagcaaagaatagctctgcagagatggaaagaagatctc
aacaggaagaagaatcataaagcaatgattctggtagaaaacactgtggatcttgaaggc
ccccctttagacttctactacattaacgagtataaacctgctccaggaataaatgtaata
aatggaataacaactggctgtgaatgcatggactgccctgctgagaagtgctgtccaaag
gaggctggatttattttggcttacaataaacataagaagttgaaaatccagcctggcttg
cccatctatgaatgcaattcgttttgtaggtgtgggcctgattgccctaataggatagta
cagaaaggtacaccatattctctttgcatcttcagaactaacaatggccgtggttgggga
gtaaaaacactccagaaaattaaaaccaacagttttgtgatggagtatgtcggagaggtg
attacaagtgaggaagcagagagacgaggccagctgtatgataaccagggaaatacatac
ttgtttgatttggactatgactcagatgaatttacagtagatgcagctcgatatggaaat
gtgtcccactttgtgaatcacagttgtgatccaaatcttcaagtcttcaatgtgtttatt
gataacctcgacttgcgtcttcctcgaatagcgctgttttctacacgaaccatcaaggct
ggagaagagctaacctttgactatcagatgaaaggttcaatagatctgacttcagactct
gctgatggtcttagcccatccagaaagaggatcagaactgtgtgtaaatgcggagctgtg
tgttgcagaggttacctcaactga

DBGET integrated database retrieval system