KEGG   Falco peregrinus (peregrine falcon): 101913445Help
Entry
101913445         CDS       T02856                                 

Gene name
TGM3
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
Enzymes [BR:fpg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101913445 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core DUF2393 A2M_N
Motif
Other DBs
NCBI-GeneID: 101913445
NCBI-ProteinID: XP_005239977
LinkDB All DBs
Position
Un
AA seq 692 aa AA seqDB search
MGQAVTQPSTNWHLKENARDHHTSKFSSKELIVRRGQAFILTFNGTEHPEQNLTFIVETG
PKPSKLAKTQATFGISSTVTKESWSAVVQSTSSSSVTISISSPPNAVIGRYKLSVQSTSS
GSSSPASLGTFVLLFNPWSSGDDVFMPNKAECEEYVLEEFGIIFAGNKNHINSFGWNFGQ
FQGDILNICLSMMDRSLNYRQDPVTDVSHRNDPKYLGRVLSAMVNANDDQGVLLGNWSGN
YEGGKSPSSWTGSGEILHNWKKSGFKPVRYGQCWVFAAVLTTVLRCLGIPTRTITNFSSA
HDADGNLRVDEFYDASGNHLDRAADSIWNFHVWNESWFSRSDLGPSYSGWQVLDATPQEE
SGGIYQCGPASRNAIKEGDVDLDYDCPFVFAEVNADCMYWNYDSTTGKKTLIFSKSTIIG
QSISTKAVGRDVRVDVTNDYKYEEGSTKEREIFKKARKKLGLEDKFDPTAPTTQEIDQKP
DISGKFKVDGPLEVGKNLNLILVLANLQSDAKTVHVNMTAWSTVYTRRPVHEIWKDSISV
TLSPKEEKQFPIKIPYTEYQQQLTTDNTIQVTALCHVEGGIQVLVQRDITLDNPNIDIQV
LGEAKVNKEVDVEVTFTNPIDVEVTDCVLQAEGNDLLRGILEIEVPPLKAGEKSSTKFKL
IPFETGPKHLLVNFSCDKFADIKTFKMVNVVD
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagctgtaacgcagccaagtaccaactggcacctgaaagaaaatgcaagagat
caccacacaagtaaattctctagcaaagagttgattgtgaggagagggcaggccttcatt
ctcaccttcaatggaacagaacaccctgagcaaaacttaacatttatcgtagaaacaggt
cccaaaccctcaaagctggctaagacccaggccacatttggtatctccagcacagtaacc
aaggagagctggagtgcagttgtacagtctaccagttccagctctgtgaccatctccatt
tccagcccacctaatgctgtcattggacgttacaagctgagtgttcagagtacatcaagt
ggcagctcctctcctgcaagccttggcacctttgttttgctctttaacccttggtcttca
ggtgatgatgtgttcatgcctaacaaggctgagtgtgaggaatacgtgctagaagagttt
ggcatcatttttgcaggcaataaaaatcatatcaacagctttggatggaactttgggcag
tttcaaggagatattctcaatatttgcctttccatgatggatcgaagcttaaactatcgt
caggatcctgtcacagatgtatcgcacagaaatgaccccaagtatctgggccgtgttctc
agtgcaatggtcaatgccaatgatgaccaaggggtgctgctaggaaactggagtggaaat
tatgagggtgggaaaagtccaagcagctggactggaagtggtgaaatcctgcacaactgg
aagaaatcaggattcaaacctgttagatatggacaatgttgggtttttgcagcagtattg
actacagtgcttagatgtctggggattcccactcgtacaattacaaacttcagctctgcc
cacgatgcagatggaaatctgcgtgtggatgagttttacgatgcatctggaaatcatttg
gacagggcagctgacagcatatggaatttccatgtctggaatgaaagctggttttcccgc
agtgacttgggcccctcatacagtggatggcaagttctggatgcaactcctcaagaagaa
agtggaggaatttatcagtgtggtcctgcctcacggaatgccatcaaagaaggagatgta
gatctggactacgactgtccattcgtatttgcagaagtgaatgcagactgcatgtactgg
aattatgactccacgactggaaagaaaacattaatattctctaagtctaccataattggt
caatccatcagcacaaaggcagttggtagagatgttcgtgtagatgtcaccaatgactac
aaatatgaagaaggctctacaaaagaaagagagatttttaaaaaagcccgtaagaagctg
ggacttgaggataaatttgatcctacagcaccgacaacacaggaaattgatcaaaagcct
gacatctcagggaagttcaaggtggatggccctttagaggttggcaaaaatctcaatcta
attctggttcttgcaaacttacagtctgatgctaagactgttcatgtcaatatgactgct
tggagcactgtgtacactagaagaccagttcatgagatctggaaggactccatatctgtc
actctgtctcctaaggaagagaaacaatttcccattaagataccatatactgaatatcaa
cagcagttaactacagacaacacgatccaggtaacagctttatgtcatgtagaaggtggg
attcaagtgctggtgcaaagagacatcaccctggacaatcctaacattgacatacaggta
cttggtgaagcaaaagtgaataaagaagtggatgtggaagtgacatttaccaatcctatt
gatgtggaagtgacagactgtgtgctgcaggcagaaggcaatgacctcctcagaggaatc
cttgagatagaggtaccaccattgaaagccggtgagaaatccagtacaaagtttaaactc
atcccttttgagacaggtcccaaacatctacttgttaatttctcctgtgataaatttgca
gatatcaagacctttaagatggtaaatgtggttgactaa

DBGET integrated database retrieval system