KEGG   Falco peregrinus (peregrine falcon): 101922530Help
Entry
101922530         CDS       T02856                                 

Definition
(RefSeq) trypsin I-P1-like
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
Neuroactive ligand-receptor interaction
Influenza A
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101922530
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101922530
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101922530
Peptidases [BR:fpg01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101922530
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101922530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 250 aa AA seqDB search
MKYILFVTFVGVAVAFPSIADDDDDDKIVGGYTCAANSVPYQVSLNSGYHFCGGSLISSQ
WVLSAAHCYKSRIQVQLGKHNLALTESTQQFINSAKVIRHPGFSASTLDNDIMLIKLSKP
AQLNRAVQTIPLPTSCVATGTTCLISGWGDTMSSTNPYPDTLQCLKAPVLSSSVCTKAYP
GKITKNMICVGFMEGGKDSCQGDSGGPVVCNGQLQGIVSWGIGCAQKGYPGVYTKVCNYV
SWIRSTMSSN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatactgtttgtcacctttgttggtgtggctgttgccttccccagcatcgct
gatgacgatgatgatgacaagattgtgggaggctacacctgtgcggcaaactctgtcccc
tatcaggtgtccctgaattctgggtatcacttttgtggaggttccctcatcagcagccag
tgggtcctgtcagctgctcactgctacaagtctcgcatccaggtacagcttgggaaacat
aacctggcactcacagaatcgacgcagcagttcatcaattcagctaaagtcatccgccac
cctggcttcagtgcctccacgctggacaatgacattatgctcatcaagctttccaaacca
gcccagctcaaccgagccgtccagaccattcctctgcccaccagctgtgtggccacaggc
accacatgcctcatctctggctggggcgacacgatgagcagtaccaatccctacccagac
accttgcagtgcctgaaggctcctgtactttcctcaagcgtgtgcaccaaagcctaccct
gggaaaattaccaagaacatgatatgtgtaggattcatggagggaggcaaagactcctgc
cagggggattctggcggtccagtggtctgcaacgggcagctccagggcattgtttcctgg
ggtatcggatgtgcacagaaaggctatcccggggtttacactaaggtctgcaattatgtc
tcctggattagatcaactatgtcttccaactga

DBGET integrated database retrieval system