KEGG   Francisella philomiragia O#319-029: BF30_485Help
Entry
BF30_485          CDS       T03617                                 

Definition
(GenBank) beta-galactosidase family protein
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
fpi  Francisella philomiragia O#319-029
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:fpi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BF30_485
Enzymes [BR:fpi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BF30_485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
494151..496118
Genome map
AA seq 655 aa AA seqDB search
MFFGVDYYPEQWDYSLIDDDLNRIADSELNCIRIAEFAWHLMEPRENEFDFSFFEMILNK
AHKLGLKVMLGTPTATVPAWLYKKDPKVFSVDENGLQRHFGGRRQACLNSPTYNKYAERI
TQKMVEAYHKHPALLLWHIDNELGHETSDMCYCNQCELEFRNYLKEVFNNDINSFNDAIG
SVFWSQTYNNFDEINIPRPTIPAPNPGMMLYFNRFRAQTTTNFLARQAKVIKEIVPNQQT
LHNFTGDYFSKAQDHTDLAEQIDIVALNNYPVWGGQQIPVNAYKTAMKLDQTRGFQRRNY
WITEQLIGAQAHNIMGFVPRPGHAKLWSFQAMARGCENLIYFRWRTATKGAEQFCYGVLD
HDNKYNHRYNEMLDIIKLAKQNQQAIQAPTQSKVALLYSMDNIYSWRIQQQSTAFNIQHE
HARLYKPFFDANISVDVLDIRHNFSSYSVLLLPVAMLITDENIARIKTFIENGGIVIATF
RAGLKEYHNEIRFGVENPIHELAGVKAEYFEPLPMGTDCKIKYQDKDLTATVWRDMLTVK
EPCKSLCNYIDEFKNYSAAVKNKVGKGEIYYIGTGIDDEYFWNDLVLDLAKKHNLDTYSS
PSDIEIVIKGEKDSKIAIILNHNRNEIEYLGLKLKAYDTQILKYLEFYELYSKYY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgttttttggtgttgactattacccagagcagtgggactattctcttattgatgatgat
ttaaatcgtatagcagattctgagttaaattgtattagaattgctgaatttgcttggcat
ctcatggagcctagagaaaatgagtttgattttagtttctttgaaatgatactaaacaaa
gctcataaactaggattaaaagtcatgttaggcacacctacagcaactgttccagcatgg
ctctataaaaaagatcctaaagttttctctgttgatgaaaatggtttacaaagacatttt
ggtggtagaagacaagcttgcctaaattcgccaacttataataagtatgctgagcgcatt
actcaaaaaatggttgaagcatatcataaacacccggctttactgctttggcacattgat
aatgagcttggtcatgaaactagtgatatgtgttattgtaaccaatgtgagttagaattt
agaaactacctaaaagaagtgtttaataatgatatcaattcatttaatgatgctattggt
tctgttttttggtctcaaacttacaacaattttgatgagataaatattcctcgtccaaca
attccagctccaaatcctggtatgatgttatacttcaatcgctttagagctcaaacaaca
acaaactttttagcaagacaagccaaggttattaaagagatagtaccaaaccaacaaact
ttacataattttacaggagactacttttctaaagcacaagatcatacagatctagcagaa
caaatagatatcgttgctttaaacaactatccagtatggggcggtcaacaaatcccagta
aatgcatataagacagctatgaagttagatcaaactagaggttttcaaagaagaaattac
tggatcacagaacaacttataggtgctcaagcacataatatcatgggatttgtacctcga
cctgggcatgctaaactttggtcatttcaagctatggctagaggctgtgaaaatctaata
tacttcagatggcgcactgctacaaaaggtgctgaacaattttgttatggtgtattagat
catgataacaaatataatcatcgctataatgagatgttagatattattaaattagcaaaa
caaaatcagcaagcgatacaagctccaacacaatcaaaagtagcattgctatactcaatg
gataatatctatagctggcgtatacagcaacaatctaccgcttttaatatccaacatgaa
cacgctagactatacaaacctttttttgatgcaaacattagtgttgatgtattagatatt
cgtcataattttagtagttactctgttttattacttccagtagctatgttaattactgat
gaaaatattgctagaatcaaaacatttatcgaaaatggtggcatagttatagctacattt
agagcaggtctaaaagaatatcataatgaaattcgttttggcgttgagaatccaattcat
gaacttgctggtgtaaaagcagaatattttgagcctcttcctatggggacagattgtaaa
atcaaatatcaagataaagatttaactgctactgtatggcgagatatgcttactgttaaa
gagccttgcaaatcattgtgcaactatattgatgaatttaaaaattatagtgctgctgta
aaaaataaagtgggcaaaggagaaatttattatataggcactggtattgatgatgaatat
ttttggaatgatttagtcttagatttagctaaaaaacataatctagatacctatagttct
ccgagtgatattgaaattgttatcaaaggtgaaaaggattctaaaattgctattatctta
aatcacaatagaaatgagatagaatatttaggacttaaacttaaagcatacgatactcaa
atattaaaatacttagagttttatgaattgtactctaaatactactaa

DBGET integrated database retrieval system