KEGG   Flavonifractor plautii: A4U99_08615Help
Entry
A4U99_08615       CDS       T04429                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fpla  Flavonifractor plautii
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fpla00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4U99_08615
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A4U99_08615
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A4U99_08615
Enzymes [BR:fpla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A4U99_08615
Peptidoglycan biosynthesis and degradation proteins [BR:fpla01011]
 Precursor biosynthesis
  Amino acid ligase
   A4U99_08615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1790480..1791529
Genome map
AA seq 349 aa AA seqDB search
MKIVVLAGGLSPERNVSLSTGTMVTEALRALGHRAGLIDLYFGLETGGADEAFFDAPVSE
AYKKISREAPDLDQVRRGRKGDSPSMFGPGVLELCRMADMVFLALHGTCGEDGRVQAAFD
LMGIPYTGAGYLGSAIAMDKDLTKRMVADVVSTPGWKTVTYTAADIDRLVETARLPLVVK
PVASGSSIGVSIAHTAEELRRSLTEGLALGGRTVLEEYIRGREIQVGILEDKALPSIEII
PKQGFYDYANKYQPGAALEVCPAEITPEEEARVRAAALRVYETLGLSVYSRADFILTEDG
EPWFLEINTLPGMTPTSLLPQEAAAAGIDYNELCQRIVHASLEARKQGR
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgttgtgctggcagggggactgtctccggagcggaatgtgtccctctccact
ggaaccatggtgaccgaggcgctgcgggcgctgggccaccgggcgggcctgatcgactta
tatttcggcctggagacgggcggggcggacgaggcattttttgacgcgcctgtgtccgag
gcctacaagaaaatcagccgcgaggctccggatctggatcaggtgcggcgcggccggaag
ggggacagccccagcatgttcggccccggggtgctggagttgtgccggatggccgacatg
gtattcctggccctccacggcacctgcggcgaggacgggcgggtgcaggccgcctttgat
ctgatgggaattccctacaccggcgcgggctatctgggcagcgccatcgccatggacaag
gatctgaccaagcggatggtggccgacgtggtgtccacccccggctggaagaccgtcacc
tacaccgccgcggacatcgaccgactggtagagactgcccgcttgcccctggtggtcaag
ccggtggccagcggctcctccatcggtgtatccatcgcccacacggcggaggagctgcgc
cggtccctcaccgaaggactggccctgggggggcgcacggtgctggaggagtacatcagg
ggccgggagatccaggtgggcatcctggaggataaagccctgccctccattgagatcatc
cccaagcagggcttttacgactatgccaacaagtaccagcccggcgccgctctggaggtc
tgcccggcggagattactccggaggaggaggcgcgtgtgcgggccgcggccctgcgggtg
tacgagacactggggctgtcggtgtactcccgcgcggacttcatcctcacggaggacggg
gagccctggttcctggagatcaacaccctgcccggcatgacacccaccagcctgctgccc
caggaggccgcggcggcgggcattgactacaacgagctgtgccagcgcattgtgcacgcc
tctctggaggcccgaaaacagggaagataa

DBGET integrated database retrieval system