KEGG   Fictibacillus phosphorivorans: ABE65_005960Help
Entry
ABE65_005960      CDS       T04282                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
fpn  Fictibacillus phosphorivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YtxC DUF2229 DUF4618 DUF4156
Motif
Other DBs
NCBI-ProteinID: ANC79301
UniProt: A0A160IRW5
LinkDB All DBs
Position
1158847..1160316
Genome map
AA seq 489 aa AA seqDB search
MNTDFSNIYINGEWRKGSSDSLMKNTNPFTEEELVTIQAATKEDLDEAYEAARIAQAEWA
NELPQNKRAVLEKVADVMQENEELILDWIIKESGSTYMKAISEFRASINILKESTTYPYR
MEGKILPSQTAGKENRVYRNPLGVIGIISPWNFPFHLAIRSIAPAIATGNAVVIKPATDT
PVTGGLIFASIFEAAGLPKGLINVIVGRGSEIGDEIVTHPTPRLISFTGSTEVGRHIGEL
AGKNLKKSALELGGNNVFIALKEADIDQAVDSALFGKFYHQGQICMAINRIFVHQDIYEE
FAETFVQRAKNLKFGDPSKKDTNVGPLINRDQVDRILKDIEASVSQGAKIRVGGNAEGNV
LEPTVITDVNNEMPLAKNEIFGPVAILIPFEKDEDVVQMANAYPYGLSGAVHSKNIEHAT
DMAHEIHTGMIHINDQSVNDEPHMPFGGEKDSGLGRFNGEWVLEEFTTLKWLSVQRTPRN
YGPFISQLK
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccgatttttcaaatatatatattaacggcgaatggcgaaaaggaagcagcgat
agtttgatgaagaacacaaatcctttcacggaagaagagcttgttacgattcaagctgcg
acgaaagaagacttggacgaagcttatgaagcggcaagaattgctcaagctgaatgggca
aatgaactcccacaaaacaagcgagctgttttagaaaaagtagctgacgttatgcaagaa
aatgaagagcttattcttgattggattataaaagaatcaggaagcacgtatatgaaagct
atctcagaatttcgagcttctatcaatatcttaaaagaatctacaacatacccttatcgt
atggaaggaaaaattcttccttcacaaacagcaggcaaggaaaacagagtgtaccgtaat
ccgttaggtgtgatcggaattattagtccttggaatttccctttccatcttgctattcga
tccatcgctcctgccatcgcgactggaaatgctgtagttattaaaccagctactgacacc
cctgttacaggtggattaatctttgcgagtatctttgaagcggctggacttccaaaaggg
ctgatcaacgttatcgtaggacggggttcagaaattggagatgagatcgtcacacatcca
actcctcgtctgatctcgtttacaggttcaacagaagtaggcagacatatcggagaactt
gctggtaagaacttaaagaaatctgctcttgaattaggcggaaataacgtatttattgcg
ttaaaagaagcagatattgatcaagcagtagattcagcattatttggaaagttttatcac
caagggcaaatttgtatggcgatcaatcgaatcttcgttcatcaagacatttatgaagaa
tttgcagaaacctttgttcaaagagcaaaaaacctaaaatttggcgacccgtccaaaaaa
gatacgaacgttggtcctttaattaacagagatcaagtagatcgaattttaaaggatatt
gaagcaagtgtttcacaaggtgcgaagattcgcgttggtggaaatgcagaaggcaatgta
ttagaaccaaccgtaatcacagatgtgaacaatgaaatgccactagcgaagaatgaaatc
tttggaccagtagctattctgatcccgtttgaaaaagatgaagacgtggttcaaatggca
aatgcttatccatacggactaagtggagctgttcattctaagaacattgaacatgcaaca
gatatggctcacgaaattcatactggtatgattcacattaacgaccaatctgttaacgac
gaacctcacatgccatttggaggagaaaaagattcaggactcggccgatttaatggcgag
tgggtgttagaagaattcactactctaaaatggttatcagtacaacgtacgccaagaaac
tatggacctttcattagccaattaaagtaa

DBGET integrated database retrieval system