KEGG   Fictibacillus phosphorivorans: ABE65_009665Help
Entry
ABE65_009665      CDS       T04282                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00020  Citrate cycle (TCA cycle)
fpn00310  Lysine degradation
fpn00380  Tryptophan metabolism
fpn01100  Metabolic pathways
fpn01110  Biosynthesis of secondary metabolites
fpn01120  Microbial metabolism in diverse environments
fpn01130  Biosynthesis of antibiotics
fpn01200  Carbon metabolism
Module
fpn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABE65_009665
  Amino acid metabolism
   00310 Lysine degradation
    ABE65_009665
   00380 Tryptophan metabolism
    ABE65_009665
Enzymes [BR:fpn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ABE65_009665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ANC77053
UniProt: A0A160ILI8
LinkDB All DBs
Position
1886046..1888901
Genome map
AA seq 951 aa AA seqDB search
MSHQRSKSENPWQGLSGPNMAYILELYDQYSVDPESVDSSFKEKFDAWGPPIEGSESNQR
TAQSFDGLDFEKLAAALKLAENIRTYGHLAANLYPVGEFPKDNHHIDPKEFNLSKEDLKA
IPPSFIWKEAPSSVKDGYEAIQMLQEVYTKTIAYEFSHVHETEERQWLNTMVETSQHYPK
FSAEDKKNLLTRLSEVEGFEKFLHKTFVGQKRFSIEGVDMLVPMLDEAAKEGCCDGAEHA
LIGMAHRGRLNVLAHVLGKPYELIFSEFHHSPNKELIPSEGSRGINFGWTGDVKYHLGAS
RLVETDQSHKIKISLANNPSHLEYVDPVVEGYTRAAQETRDKKGYPVQDTSKAFAILIHG
DAAFPGEGIVAETLNLSRLRGYHTGGTLHIIANNLVGFTTDSGDSRSTKYASDLAKGFEI
PIIHVNADDPEACIAAVHLAYEYRKKFQKDVLIDLIGYRRFGHNEMDDPSATQPRLYKQV
NSHPTVRDVYAKQLVNEGVLSEEEVKSIENDVLTKHQTEYEKVQGRKEKFKLEDTRLPDP
LSKALPDIDTTISVSDLQELTENMLKFPEDFNVYPKIKRILERRRKSFQGEKIDWGMAES
LAFASILKDGTPIRITGQDSERGTFAQRHLVLNDSESGKKFSPLHAMDDIDVSFAIHNSP
LSESSVVGFEYGYNVFAPETLVIWEAQYGDFANVAQVLFDQFLSAGRAKWGQKSGMVMLL
PHGYEGQGPEHSSARLERFLQLGAENNWTVANVSTASQYFHLLRRQAKLLSMDEVRPLVV
MTPKSLLRDTKVASMAEAFESDHFMPLLQQPGLGKEKDKVKKILLCSGKIAIDLEKALEQ
DQVARTEMHIVRVEQIYPFPEEEMNALLKEYPNVEDLIWVQEEPKNMGSWLYIEPKLRAV
APQAHVSYIGRQERSSTAGGEPDIYKKEQEQIIQTSLALDIQSREGGREHV
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatcaacgttccaaatcagaaaatccttggcagggactaagtggaccaaatatg
gcctacatccttgaactatatgatcaatatagtgtggatccggaatctgttgacagttca
ttcaaagagaaatttgatgcttgggggcctccgatcgagggctctgaatcaaatcaacgt
actgcacagagttttgatggattggatttcgagaaattagcagctgcactaaaattagca
gaaaacattcgcacatacggtcacttagcagctaacttataccctgtaggggaatttccg
aaagataaccaccatattgacccgaaagaatttaacttatcaaaagaagatttgaaagcg
ataccaccttcctttatttggaaagaagcgccatctagtgttaaagacggctatgaagcg
atccaaatgcttcaggaagtgtataccaaaaccatcgcttatgagttcagtcatgtacat
gagactgaagaacgccaatggttaaacaccatggttgaaacaagccaacactatcctaaa
ttttcggctgaagataagaagaaccttttaacacgattgagtgaagttgaaggttttgag
aaattccttcataaaacattcgttggacaaaagcgtttctctatcgaaggcgttgatatg
ctggtacctatgcttgatgaagcagctaaagaaggatgctgtgacggagctgaacatgct
ttgatcggaatggcacaccgtgggcgtctaaacgtacttgctcacgtgcttggcaaacct
tacgaattaattttctcagaatttcatcattctccaaacaaagagctaattccttctgaa
ggttcgagaggaattaactttggttggactggagatgtaaagtaccatttaggtgcaagc
cgtttagttgaaacagatcaatctcataaaattaaaatctcacttgcaaataacccaagt
cacttagagtatgtagatccagtagttgaaggatatacaagagcagctcaggaaacacgt
gacaaaaaaggttatccggttcaagatacttctaaagcctttgccatccttattcatggt
gatgctgcatttccaggtgaaggaatcgttgctgaaacattgaatttaagtcgccttaga
ggatatcacacgggtggaacacttcatatcatcgcgaacaatctagtaggttttacaaca
gatagcggcgattctcgttcaacgaaatatgcgagtgaccttgcaaaaggatttgagatc
ccgattattcacgttaatgcagatgatccagaagcatgtattgcagctgtacatcttgct
tatgaatatcgtaaaaagttccaaaaagacgttctgatcgatctgatcggatatcgtcgt
ttcggtcacaatgaaatggacgatccatcagcaacacagccaagattgtataaacaagta
aacagtcatccgacagttcgtgacgtttatgcaaaacagctcgttaatgagggagtactt
tctgaagaagaagtaaagtccattgaaaatgatgtattaacaaagcatcagactgaatat
gaaaaagttcaaggtcgtaaagaaaaattcaaattggaagacacacgacttcctgatccg
ttatcgaaagcacttcctgatatcgataccacaatctcagttagtgatcttcaagaactt
acagagaacatgcttaagttcccagaagactttaacgtttaccctaaaatcaagagaatc
ctcgaacgcagacgcaagtctttccaaggggaaaagatcgattggggtatggctgaatca
ttagctttcgcttccattcttaaggatggaacaccgattcgtatcactgggcaagattct
gaacgtggtacattcgcgcaaagacaccttgttctaaacgatagtgaaagcggaaagaaa
ttttctccgctgcatgcgatggatgacatcgatgtttcgtttgcgattcataacagccca
ctttcagaatcatcagttgttggttttgagtacggttataatgtgtttgcacctgaaacc
cttgttatttgggaagcgcaatacggagattttgcgaacgtagcacaagttctgttcgat
cagttcttatctgctggccgtgcgaagtgggggcaaaaatcaggtatggtaatgcttctt
cctcacggatacgaaggtcaaggacctgagcattcaagtgcacgtctagagagattctta
cagttaggtgcagaaaataactggacagttgctaacgtaagtacagcatcacagtacttc
catctgcttagacgtcaagcgaagcttctatcgatggatgaagttcgtccgttggttgtt
atgacacctaagagcttgctgcgtgacacgaaagtggcatccatggcggaagcttttgaa
agtgatcactttatgccattgttacaacagcctggtctaggcaaagaaaaagacaaagtg
aaaaaaatcttgctttgctctggtaagatcgcgatcgatcttgaaaaagcgcttgagcaa
gatcaagtagcaagaacggaaatgcatatcgtccgtgttgaacagatctatccgttccca
gaagaagagatgaatgctctattaaaagagtatccaaacgttgaagacttgatctgggtg
caagaagagccgaagaacatgggatcatggttatacatcgaacctaaacttcgtgcagta
gcaccacaagcacacgtttcttatattggacgtcaagaacgttcgagtacggctggtggg
gaaccagacatctataaaaaagagcaagaacaaatcatccaaacatcattagcactagac
attcaatcgcgagagggaggccgtgaacatgtttga

DBGET integrated database retrieval system