KEGG   Flavobacterium psychrophilum 950106-1/1: IB65_12170Help
Entry
IB65_12170        CDS       T03412                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fpq  Flavobacterium psychrophilum 950106-1/1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpq00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IB65_12170
  Amino acid metabolism
   00310 Lysine degradation
    IB65_12170
   00380 Tryptophan metabolism
    IB65_12170
Enzymes [BR:fpq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     IB65_12170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2605760..2608531
Genome map
AA seq 923 aa AA seqDB search
MDRFSFLNAAHTEFFAQLYDQYLENPDSIEPSWRSFFQGFDFGMTTYSEENAANQMANIA
TTNVDNGQVSDKILKEFNVLKLIDGYRTRGHLFTQTNPVRERRHYTPTLELSDFGLTDSD
LNTVFDAAKIIGHQPSTLQEIIIHLKNVYCQHIGIEYMYMRNPEIIQWVQNKINTNDNQP
NFDNNQKKIILEKLNEAVSFENFLHTKYVGQKRFSLEGGETIIAGLDALIEAAADKGVEK
FVMGMAHRGRLNVLANIFKKSTQDIFSEFDGKDYDQEYFDGDVKYHLGLTSDRKTRSGKN
ININLAPNPSHLETVGAVIEGITRAKQDKYFPNDFSKVLPIAVHGDAAIAGQGILYEIIQ
MAQLDGYKTGGTIHIVINNQVGFTTNYLDARSSTYCTDIAKVTLSPVLHVNADDAEAVVH
AMLFALDFRMQFGRDVFIDLLGYRKYGHNEGDEPRFTQPLLYKIIAKHKNPRDIYAEKLL
AQNIIDGNFVKELETSYKQDLDDNLEASRKKSLTVITPFMQNEWEGFVQVSDDVMLQKVN
TKFDKKELDSIIETISTLPSDKKFINKISKIVNDRKTMYDNNTIDWGTAETLAYGSLLTE
GYDVRISGQDVERGTFSHRHAVVKVEDSEEEVVLLNDIKGKKGNFNVFNSHLSEYGVLGF
DYGYALANPNALTIWEAQFGDFSNGAQIMIDQYISCGEDKWNNQNGIVMLLPHGYEGQGA
EHSSGRMERYLQLCARHNMVVADCTTPANFFHLLRRQMLTKYRKPLIVFTPKSLLRDPRC
VSTQDEIANGEFQETIDDISVNKTQVKTLVFCTGKFYYDITAERENLQRNDVAVVRIEQM
FPLPVEQLKAIVASYPNADDYVWAQEEPKNMGAYSFMLMNFDFIKWRLASLKAYAAPAAG
SYTRAKRRHADAIRMVFDKDLFR
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggataggttttcatttttaaacgcagctcacacagaatttttcgcacaattatacgac
caatatctcgaaaatccagatagtatcgagccttcttggaggagtttctttcagggtttc
gattttggaatgacaacttatagcgaagaaaacgcagcaaatcagatggcgaatatcgct
acaacaaatgtagataacggtcaagtttcagataaaattctaaaagaatttaatgtattg
aaactaatagatggttatagaactcgtgggcatttatttacccaaaccaaccctgttcgt
gagcgaagacattacacgccaacattagaactgtcagattttggtcttaccgattccgat
ttgaatactgtcttcgatgcagcaaaaataattggacaccagccatcaaccttacaagaa
ataattattcacctcaaaaacgtatattgccaacatattggtatcgaatatatgtatatg
agaaatcctgaaatcattcaatgggttcagaacaaaataaacacaaacgacaatcagcct
aattttgataacaatcagaaaaaaattatcctcgaaaaactaaatgaagctgtttcgttc
gaaaactttttacatactaaatatgtaggtcaaaaacgattttcattagaaggaggagaa
actataattgctggtttagacgctcttatagaagccgccgctgataaaggtgtcgaaaaa
tttgtaatgggaatggcacaccgtggccgtttaaacgttttagcaaatatttttaaaaaa
tcaacacaagatatcttctcggaatttgacggaaaagattacgaccaagaatatttcgat
ggtgatgtaaaataccatttgggtttaacctccgataggaaaacacgatcaggaaaaaac
atcaatatcaatttagccccaaacccttcacacctagaaactgttggagctgttattgaa
ggaattactcgtgccaaacaagacaaatattttcctaacgatttctcgaaagtattgcct
atcgccgttcacggtgatgccgcaattgcaggacaaggaatcctatacgaaattatccag
atggcacaactagacggttacaaaactggcggaactattcatatagtgattaacaatcaa
gttggttttacaactaattatcttgatgcacgctcatcaacttattgtaccgatattgca
aaagtaacactatcaccagtattacacgtaaatgcagatgatgccgaagctgttgtacac
gccatgctttttgctctagatttcagaatgcaatttggtcgtgacgtatttatagattta
ttaggatacagaaaatatggtcataacgaaggcgacgaacctcgttttacacaaccatta
ttatacaaaatcattgcaaaacacaaaaacccacgtgatatttatgccgaaaaattatta
gcacaaaacatcatcgatggcaattttgtaaaagaattagaaacatcatacaaacaagat
ttagatgacaatctagaagcatcacgtaaaaaatcactcacagtaatcacgccatttatg
caaaatgaatgggaaggatttgtgcaggtttcagatgacgtaatgcttcaaaaagtaaat
acaaaatttgataaaaaagaattagattctatcatagaaaccatttcgacattgccatcg
gacaagaaatttatcaataaaatttctaaaattgtcaatgacagaaaaacgatgtacgac
aacaacaccatcgactggggaactgccgaaaccttggcctatggttcgctactaacagaa
ggttacgatgttcgtatctcaggacaagatgtagaaagaggaacattctcacaccgtcac
gccgttgtaaaagtagaagatagcgaagaagaagttgttttattaaacgatataaaaggg
aaaaaaggaaacttcaatgttttcaattcacacctttcagaatacggagtcttaggattc
gattacggatatgcactagcaaacccaaatgctttaaccatttgggaagcacaatttggc
gatttcagtaatggagcccaaattatgatagaccaatacatttcgtgcggagaagacaaa
tggaacaaccaaaacggtatcgtaatgttgttgcctcacggatacgaagggcaaggagca
gaacactcctcaggaagaatggaacgctacttacaactttgtgcacgccataatatggtt
gttgccgattgtacaacacccgccaatttcttccacctactaagaagacaaatgcttaca
aaataccgcaaaccattaattgtgtttaccccaaaaagtttgcttcgtgatcctagatgt
gtctctacacaagacgaaatcgcaaatggtgagtttcaagaaactatcgatgatatttca
gtaaataaaacccaggttaaaacattagttttctgtacaggaaaattctattacgacatt
actgccgaaagagaaaacctacaaagaaacgatgttgcagtggtaagaatcgaacaaatg
ttcccgttaccagtagaacaattaaaagcaattgtggcaagctatccaaatgcagatgat
tatgtttgggcacaagaagaacctaaaaacatgggagcttatagttttatgctaatgaat
ttcgatttcataaaatggagattggcatcgttaaaagcatacgccgcaccagcagcagga
agttataccagagcaaaacgccgtcacgccgatgcaattagaatggttttcgacaaagat
ttgtttagataa

DBGET integrated database retrieval system