KEGG   Flavobacterium psychrophilum JIP02/86: FP1736Help
Entry
FP1736            CDS       T00548                                 

Gene name
sodC
Definition
(RefSeq) Superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Brite
Enzymes [BR:fps01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FP1736 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 5300295
NCBI-ProteinID: YP_001296610
UniProt: A6H0D0
LinkDB All DBs
Position
1561868..1562389
Genome map
AA seq 173 aa AA seqDB search
MKNLLLLSCALIFTLIACKSSAGNKNEIKTIFSPKSQSNVAGTANFIEKNGTVTMVANLS
GLTPGEHAIHIHEKSDCSATDGSSAGGHWNPTFKKHGKWGSAEHHKGDIGNFTADLNGNA
TIKFSTSEWCIGCQDPTKDILGKGLIVHKGTDDFTSQPAGNAGARVACSAIIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttacttctactatcatgcgctcttatttttaccctaatagcttgcaaaagt
agcgcaggaaataaaaacgaaataaaaacaatattttctccaaaaagccaaagcaatgta
gctggaactgctaattttattgagaaaaacggaacagtaacaatggttgcaaacctaagc
ggacttacccctggagaacacgccattcacatacacgaaaaatctgattgttctgctacc
gatggaagttctgctggcgggcactggaatccaactttcaaaaaacatggcaaatggggc
tcagcagagcatcataaaggagatattggcaattttactgccgatctaaacggaaatgct
acaataaaattctctacttcagagtggtgtattggctgccaagatccaactaaagatatt
ctaggcaaaggactaatcgttcataaaggaactgacgattttacatcgcaacctgccgga
aatgcaggcgcaagagtagcttgctcagcaattatcaaataa

DBGET integrated database retrieval system