KEGG   Flavobacterium psychrophilum V4-24: IA04_11830Help
Entry
IA04_11830        CDS       T03660                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fpw  Flavobacterium psychrophilum V4-24
Pathway
fpw00020  Citrate cycle (TCA cycle)
fpw00310  Lysine degradation
fpw00380  Tryptophan metabolism
fpw01100  Metabolic pathways
fpw01110  Biosynthesis of secondary metabolites
fpw01120  Microbial metabolism in diverse environments
fpw01130  Biosynthesis of antibiotics
fpw01200  Carbon metabolism
Module
fpw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpw00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    IA04_11830
  Amino acid metabolism
   00310 Lysine degradation
    IA04_11830
   00380 Tryptophan metabolism
    IA04_11830
Enzymes [BR:fpw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     IA04_11830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PhaC_N
Motif
Other DBs
NCBI-ProteinID: AIG37920
UniProt: A0A076P714
LinkDB All DBs
Position
2553880..2556651
Genome map
AA seq 923 aa AA seqDB search
MDRFSFLNAAHTEFFAQLYDQYLENPDSIEPSWRSFFQGFDFGMTTYSEENAANQMANIA
TTNVDNGQVSDKILKEFNVLKLIDGYRTRGHLFTQTNPVRERRHYTPTLELSDFGLTDSD
LNTVFDAAKIIGHQPSTLQEIIIHLKNVYCQHIGIEYMYMRNPEIIQWVQNKINTNDNQP
NFDNNQKKIILEKLNEAVSFENFLHTKYVGQKRFSLEGGETIIAGLDALIEAAADKGVEK
FVMGMAHRGRLNVLANIFKKSTQDIFSEFDGKDYDQEYFDGDVKYHLGLTSDRKTRSGKN
ININLAPNPSHLETVGAVIEGITRAKQDKYFPNDFSKVLPIAVHGDAAIAGQGILYEIIQ
MAQLDGYKTGGTIHIVINNQVGFTTNYLDARSSTYCTDIAKVTLSPVLHVNADDAEAVVH
AMLFALDFRMQFGRDVFIDLLGYRKYGHNEGDEPRFTQPLLYKIIAKHKNPRDIYAEKLL
AQNIIDGNFVKELETSYKQDLDDNLEASRKKSLTVITPFMQNEWEGFVQVSDDVMLQKVN
TKFDKKELDSIIETISTLPSDKKFINKISKIVNDRKTMYDNNTIDWGTAETLAYGSLLTE
GYDVRISGQDVERGTFSHRHAVVKVEDSEEEVVLLNDIKGKKGNFNVFNSHLSEYGVLGF
DYGYALANPNALTIWEAQFGDFSNGAQIMIDQYISCGEDKWNNQNGIVMLLPHGYEGQGA
EHSSGRMERYLQLCARHNMVVADCTTPANFFHLLRRQMLTKYRKPLIVFTPKSLLRDPRC
VSTQDEIANGEFQETIDDISVNKTQVKTLVFCTGKFYYDITAERENLQRNDVAVVRIEQM
FPLPVEQLKAIVASYPNADDYVWAQEEPKNMGAYSFMLMNFDFIKWRLASLKAYAAPAAG
SYTRAKRRHADAIRMVFDKDLFR
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atggataggttttcatttttaaacgcagctcacacagaatttttcgcacaattatacgac
caatatctcgaaaatccagatagtatcgagccttcttggaggagtttctttcagggtttc
gattttggaatgacaacttatagcgaagaaaacgcagcaaatcagatggcgaatatcgct
acaacaaatgtagataacggtcaagtttcagataaaattctaaaagaatttaatgtattg
aaactaatagatggttatagaactcgtgggcatttatttacccaaaccaaccctgttcgt
gagcgaagacattacacgccaacattagaactgtcagattttggtcttaccgattccgat
ttgaatactgtcttcgatgcagcaaaaataattggacaccagccatcaaccttacaagaa
ataattattcacctcaaaaacgtatattgccaacatattggtatcgaatatatgtatatg
agaaatcctgaaatcattcaatgggttcagaacaaaataaacacaaacgacaatcagcct
aattttgataacaatcagaaaaaaattatcctcgaaaaactaaatgaagctgtttcgttc
gaaaactttttacatactaaatatgtaggtcaaaaacgattttcattagaaggaggagaa
actataattgctggtttagacgctcttatagaagccgccgctgataaaggtgtcgaaaaa
tttgtaatgggaatggcacaccgtggccgtttaaacgttttagcaaatatttttaaaaaa
tcaacacaagatatcttctcggaatttgacggaaaagattacgaccaagaatatttcgat
ggtgatgtaaaataccatttgggtttaacctccgataggaaaacacgatcaggaaaaaac
atcaatatcaatttagccccaaacccttcacacctagaaactgttggagctgttattgaa
ggaattactcgtgccaaacaagacaaatattttcctaacgatttctcgaaagtattgcct
atcgccgttcacggtgatgccgcaattgcaggacaaggaatcctatacgaaattatccag
atggcacaactagacggttacaaaactggcggaactattcatatagtgattaacaatcaa
gttggttttacaactaattatcttgatgcacgctcatcaacttattgtaccgatattgca
aaagtaacactatcaccagtattacacgtaaatgcagatgatgccgaagctgttgtacac
gccatgctttttgctctagatttcagaatgcaatttggtcgtgacgtatttatagattta
ttaggatacagaaaatatggtcataacgaaggcgacgaacctcgttttacacaaccatta
ttatacaaaatcattgcaaaacacaaaaacccacgtgatatttatgccgaaaaattatta
gcacaaaacatcatcgatggcaattttgtaaaagaattagaaacatcatacaaacaagat
ttagatgacaatctagaagcatcacgtaaaaaatcactcacagtaatcacgccatttatg
caaaatgaatgggaaggatttgtgcaggtttcagatgacgtaatgcttcaaaaagtaaat
acaaaatttgataaaaaagaattagattctatcatagaaaccatttcgacattgccatcg
gacaagaaatttatcaataaaatttctaaaattgtcaatgacagaaaaacgatgtacgac
aacaacaccatcgactggggaactgccgaaaccttggcctatggttcgctactaacagaa
ggttacgatgttcgtatctcaggacaagatgtagaaagaggaacattctcacaccgtcac
gccgttgtaaaagtagaagatagcgaagaagaagttgttttattaaacgatataaaaggg
aaaaaaggaaacttcaatgttttcaattcacacctttcagaatacggagtcttaggattc
gattacggatatgcactagcaaacccaaatgctttaaccatttgggaagcacaatttggc
gatttcagtaatggagcccaaattatgatagaccaatacatttcgtgcggagaagacaaa
tggaacaaccaaaacggtatcgtaatgttgttgcctcacggatacgaagggcaaggagca
gaacactcctcaggaagaatggaacgctacttacaactttgtgcacgccataatatggtt
gttgccgattgtacaacacccgccaatttcttccacctactaagaagacaaatgcttaca
aaataccgcaaaccattaattgtgtttaccccaaaaagtttgcttcgtgatcctagatgt
gtctctacacaagacgaaatcgcaaatggtgagtttcaagaaactatcgatgatatttca
gtaaataaaacccaggttaaaacattagttttctgtacaggaaaattctattacgacatt
actgccgaaagagaaaacctacaaagaaacgatgttgcagtggtaagaatcgaacaaatg
ttcccgttaccagtagaacaattaaaagcaattgtggcaagctatccaaatgcagatgat
tatgtttgggcacaagaagaacctaaaaacatgggagcttatagttttatgctaatgaat
ttcgatttcataaaatggagattggcatcgttaaaagcatacgccgcaccagcagcagga
agttataccagagcaaaacgccgtcacgccgatgcaattagaatggttttcgacaaagat
ttgtttagataa

DBGET integrated database retrieval system