KEGG   Francisella philomiragia GA01-2794: LA55_1994Help
Entry
LA55_1994         CDS       T03620                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fpz  Francisella philomiragia GA01-2794
Pathway
fpz00250  Alanine, aspartate and glutamate metabolism
fpz00410  beta-Alanine metabolism
fpz00430  Taurine and hypotaurine metabolism
fpz00650  Butanoate metabolism
fpz01100  Metabolic pathways
fpz01110  Biosynthesis of secondary metabolites
fpz01120  Microbial metabolism in diverse environments
fpz02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fpz00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    LA55_1994
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LA55_1994
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LA55_1994
   00430 Taurine and hypotaurine metabolism
    LA55_1994
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    LA55_1994
Enzymes [BR:fpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LA55_1994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AJI53611
UniProt: A0A0B6D402
LinkDB All DBs
Position
complement(2043647..2044987)
Genome map
AA seq 446 aa AA seqDB search
MALHAKNNIKHKLYKESLPKFEIPKKSNDAFEAYQQIKDELMLDGNSKQNLATFCQTEVD
DFIHKLMDDCIDKNMIDKDEYPQTAEIESRCVNILANLWNSSAESAIGCSTTGSSEAAML
GGMAMKWRWRDKMKAQGKDYTKPNLVTGPVQVCWHKFARYWDIELREIPMSNESLIMTPE
TMLKYCDENTIGVVPTLGVTFTGQYEPVEAVCEALDKFERDTGIDIPVHVDAASGGFLAP
FVEPELKWDFRLPRVKSINSSGHKFGLSPLGVGWVVWADKKYLPQDLIFNVNYLGGDMPT
FALNFSRPGGQIVAQYYNFVKLGFEGYKNIHKLSYDVAKYIAKEIKDMGIFDIIHAGKGG
IPAVSWSLKAGKSYDLFDISEKIRARGWQIAAYSMPKDRQDLVVMRVLVRRGFSFDLAEL
MIRDLKNVIDSLEHKSRDIERGGFSH
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggctttacatgccaaaaacaatatcaaacataaattgtataaagaatcattaccaaaa
tttgaaattcccaaaaaatcaaatgatgcttttgaagcataccaacaaatcaaagatgag
ttaatgctcgatggtaattcaaagcagaatttggcgacattttgtcaaacagaagttgat
gattttattcataagcttatggatgattgcattgataaaaatatgattgataaagatgaa
tatcctcaaactgcagaaatagagtcgcgatgtgtcaacatactagcaaacctatggaac
tcttcagcagaaagtgcaattggctgctcaactactggctcatctgaagcagctatgctt
ggcggtatggcgatgaaatggcgctggagagataagatgaaagcacaaggtaaagattat
acaaaacctaatcttgttacaggacctgtgcaagtctgctggcataaattcgctagatat
tgggatattgagcttagagagattccgatgtcaaatgaaagtttaataatgactccagaa
actatgcttaagtactgtgatgaaaatacaattggagttgtgccgactttaggggttacc
tttacaggtcagtacgagcctgttgaggcagtttgtgaagcacttgataaatttgagaga
gatactggtattgatattccagtgcatgtggatgctgcttctggaggatttttggcacca
tttgtagagcctgaacttaagtgggattttagattaccaagagttaagtcaattaattca
tcaggacataagtttgggttatcgccattaggagtgggttgggttgtttgggcagataag
aaatacttacctcaagatttgatttttaatgttaattatctcggtggcgatatgccgaca
tttgctttgaatttctctcgacctggtggtcagatagttgcccaatattataactttgtt
aagcttggttttgaaggatataaaaatatccataagcttagttatgatgttgcaaaatat
attgctaaagaaattaaggatatgggtatctttgatattattcatgctggcaaaggaggt
attcctgcagtgagttggtcacttaaggcaggcaaaagttatgatttgtttgatatctct
gaaaaaattcgagctagaggttggcagatagcggcttattcgatgccaaaagataggcaa
gacttggtagttatgcgagtgcttgttagaagaggctttagctttgatttagcggagctc
atgattagggatctaaaaaatgttattgactctttagagcataaatctagagatattgaa
agaggtggtttttcgcattag

DBGET integrated database retrieval system