KEGG   Francisella philomiragia GA01-2794: LA55_533Help
Entry
LA55_533          CDS       T03620                                 

Definition
(GenBank) beta-galactosidase family protein
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
fpz  Francisella philomiragia GA01-2794
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:fpz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LA55_533
Enzymes [BR:fpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     LA55_533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(526063..528033)
Genome map
AA seq 656 aa AA seqDB search
MYFGVDYYPEQWDYSLIDDDLNRIANSELNCIRIAEFAWHLMEPRENEFDFSFFEMILNK
AHKLGLKVMLGTPTATVPAWLYKKDPKIFSIDENGLQRHFGGRRQACLNSPTYNKYAERI
TQKMVEAYHKHPALLLWHIDNELGHETSDMCYCDQCELEFRNYLKEEFNNNINSFNDAIG
SVFWSQTYNNFDEINIPRPTIPAPNPGMMLYFNRFRAQTTTNFLARQAKVIKDIVPNQQT
LHNFTGDYFSKAQDHTDLAEQIDIVALNNYPVWGGQQVPVDTHKTAMKLDQTRGFHRKNY
WITEQLIGAQAHNVMGFVPRPGHAKLWSFQAMARGCENLIYFRWRTATKGAEQFCYGVLD
HDNKYNHRYNEMLDIIKLAKQNQQAIKSPTQSKVALIYSMDNIYSWRIQQQSTAFNIQHE
HARLYKPFFDANISVDVLDIRHNFSSYSILLLPVAMLITDENIARIKTFIKNGGTVIATF
RAGLKEYHNEIRFGVENPIHELAGVKAEYFEPLPIGADCKIKYQGKDLAATVWRDMLTVK
ESSKSLCNYIDEFENYSAAVKNKVGKGEIYYIGTGIDDEYFWNDLVLDLAKKHHLDTYSS
PSDIEVVIKGEKDSKIAIILNHNGNEIEYLGLKLKAYDTQILEYSEFYELYSKYYQ
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcggtgttgactattacccagaacaatgggactactctcttattgatgatgat
ttaaatcgtatagcaaattctgagttaaattgtattagaattgctgaatttgcttggcat
ctaatggagcctagggagaatgagtttgattttagtttctttgaaatgatactaaataaa
gctcataaactaggattaaaagtcatgttaggcacacctacagcaactgttcctgcatgg
ctatataaaaaagatcctaaaattttctctattgatgaaaatggtttacaaagacatttt
ggtggtagaagacaagcttgcctaaattcgccaacttataataagtatgctgagcgcatt
actcaaaaaatggttgaagcatatcataaacacccagctttactgctttggcacattgat
aatgagcttggtcatgaaactagtgatatgtgttattgtgatcagtgtgaattggagttt
agaaactatctaaaagaagagtttaataataatatcaattcatttaatgatgctattggt
tctgttttttggtctcaaacttacaacaattttgatgagataaatattcctcgtccaaca
attccagctccaaatccaggtatgatgttatacttcaatcgctttagagctcaaacaaca
accaactttttagcaagacaagctaaggttattaaagatatagtaccaaaccaacaaact
ttacataattttactggggactacttttctaaagcacaagatcatacagatctagcagaa
caaatagatatcgttgctttaaacaactatccggtatggggtggtcaacaggtccccgta
gatacgcataaaacggctatgaagttagatcaaactagaggttttcatagaaaaaattac
tggatcacagaacaactgataggtgctcaagctcataatgtaatgggatttgtacctagg
cctggacatgctaaactttggtcattccaagctatggctagaggctgtgaaaatctaata
tacttcagatggcgcactgctacaaaaggtgctgaacaattttgctacggtgtactagac
catgataataaatataatcatcgctataatgagatgttagatattattaaattagcaaaa
caaaatcagcaagcgataaagtctcctacacaatcaaaagtagctttgatatattcaatg
gataatatctatagctggcgtattcagcaacaatcaacagcttttaatatccaacatgaa
cacgctaggctatacaaacctttttttgatgcaaacattagtgttgacgtattagatatt
cgtcataattttagtagttactctattttattacttccagtagctatgttaattactgat
gaaaatattgctagaatcaaaacattcatcaagaatggtggcacagttatcgctacattt
agagcaggtctaaaagaatatcataatgaaattcgttttggcgttgagaatccaattcat
gaacttgctggtgtaaaagcagaatattttgagccgcttcctataggagcagattgtaaa
atcaaatatcaaggtaaagatttagctgctaccgtatggcgtgatatgcttacagttaaa
gagtctagcaagtcactatgtaactatattgatgaatttgaaaattatagtgctgctgta
aaaaataaagtcggcaagggagaaatttattatataggcaccggtattgatgatgaatat
ttttggaatgatttagtcttagatttagctaaaaaacatcatttagatacttatagttct
ccgagtgacattgaagttgttatcaaaggtgaaaaggattctaaaattgctattatctta
aatcacaatggaaatgaaatagaatatttagggcttaaacttaaagcatatgatactcaa
atattagaatactcagagttttatgaattatactctaaatattaccaatag

DBGET integrated database retrieval system