KEGG   Frankia sp. CcI3: Francci3_0181Help
Entry
Francci3_0181     CDS       T00320                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fra  Frankia sp. CcI3
Pathway
fra00250  Alanine, aspartate and glutamate metabolism
fra00410  beta-Alanine metabolism
fra00430  Taurine and hypotaurine metabolism
fra00650  Butanoate metabolism
fra01100  Metabolic pathways
fra01110  Biosynthesis of secondary metabolites
fra01120  Microbial metabolism in diverse environments
fra02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Francci3_0181
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Francci3_0181
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Francci3_0181
   00430 Taurine and hypotaurine metabolism
    Francci3_0181
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Francci3_0181
Enzymes [BR:fra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Francci3_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ABD09573
JGI: Francci30181
RhizoBase: Francci3_0181
UniProt: Q2JGL9
LinkDB All DBs
Position
212677..214077
Genome map
AA seq 466 aa AA seqDB search
MALHRQASGDRAEETVDVRPHLAPLGEEVVVPRFRMPQESTAPETAYQIVHDELMLDGKA
RLNMATFVTTWMDSYADRLMAECAPKNMIDKDEYPQTAALEERCVNILADLWHAPDAEHA
VGCSTTGSSEACMLAGLAMIRRWRARRRSAGAPADRPNIVMGVNVQVCWEKFARYWDVEA
RLVPMAPGRTHLTADEAVAHCDENTIGVVAILGSTFDGSYEPVAGIVAALDHLAASGGPD
VPVHVDAASGGFIAPFCDPDLVWDFQLDRVVSINTSGHKYGLVYPGVGWVLWRDRAHLPA
ELVFQVDYLGGTMPTFALNFSRPGAQVVAQYYTLLQLGYKGYRRVAQACRDNARWLAAEV
AAMGPFELVSDGSGIPAFAFKLRDDITDYTVFDVSELLRTRGWLVPAYRFPPGLTDLAVL
RVVVRHEFSRDLAGLLIADLRRVVNRLAHPGRRTAGDRPGESSFHH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggctctacatcgtcaggcgagtggtgatcgggcggaggagacggtcgacgtacggccg
cacctggccccgctgggcgaggaggtcgtagtcccgcggttccggatgccgcaggagtcg
actgcgccggagacggcctaccagatcgtccacgacgagctgatgctcgacggcaaggcg
cggctgaacatggccacgttcgtgaccacctggatggactcgtacgccgaccggctgatg
gccgagtgcgccccgaagaacatgatcgacaaggatgagtatccgcagacggcggcgctg
gaggaacgctgcgtcaacatcctcgccgacctgtggcacgcccccgacgccgagcacgcg
gtcggctgctcgaccacggggtcgtccgaggcgtgcatgctcgccgggcttgccatgatc
cgccgctggcgggcgcgtcgccggtccgccggcgccccggccgaccggccgaacatcgtc
atgggtgtcaacgtgcaggtgtgctgggagaagttcgcccggtactgggacgtggaggca
cggctggtgccgatggcgccggggcgcacgcatctgaccgccgacgaggccgtggcgcac
tgcgacgagaacaccatcggcgtggtggcgatcctcggctcgacgttcgacggcagctac
gagccggtcgccgggatcgtggccgcgctggaccacctcgccgcctccggagggcccgat
gttccggtacacgtggatgccgcgtccggcgggttcatcgccccgttctgcgaccccgat
ctggtctgggactttcagctcgaccgggtggtgtccatcaacacctccgggcacaagtac
ggcctggtctatccgggggtgggctgggtgctgtggcgcgaccgggcgcatctaccggcc
gaactcgtcttccaggtggactatctgggcgggacgatgccgaccttcgcgctgaacttc
tcccggccgggcgcacaggtcgtcgcgcagtactacaccctgctgcaactgggctataag
ggctaccgccgggtggcccaggcgtgtcgggacaacgcccgctggctggccgccgaggtg
gcggcgatggggccgttcgaactggtctccgacggtagcggcattccggcgttcgcgttc
aagctccgtgacgacatcacggactacaccgtcttcgacgtctccgagctgctgcgcacc
cgtggctggctggtgcccgcctaccggttcccgccggggctgaccgatcttgcggtgttg
cgggtcgtcgtgcgtcacgagttcagccgggacctcgccgggctgctcatcgccgacctg
cgccgggtggtgaaccggctggcccatccgggccggcgcaccgcgggcgaccggcccggc
gagtcatcgttccaccactga

DBGET integrated database retrieval system