KEGG   Frankia sp. CcI3: Francci3_1678Help
Entry
Francci3_1678     CDS       T00320                                 

Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
fra  Frankia sp. CcI3
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fra00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Francci3_1678
   01230 Biosynthesis of amino acids
    Francci3_1678
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Francci3_1678
   00620 Pyruvate metabolism
    Francci3_1678
  Nucleotide metabolism
   00230 Purine metabolism
    Francci3_1678
Enzymes [BR:fra01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Francci3_1678
Exosome [BR:fra04147]
 Exosomal proteins
  Proteins found in most exosomes
   Francci3_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
2013257..2014672
Genome map
AA seq 471 aa AA seqDB search
MPRRAKIVCTLGPATSSPEKVRALVDAGMDIARLNFSHGTHEQHAVTYARVREAAEAAGR
SVGTLADLQGPKIRLGNFADGGVTLLPGQRFTVTIRDVPGDQHQVGTTYPGLPGDVAAGD
RVLVDDGRLVLQIDGVTDTDVHTTVVVGGPVSDHKGMNIPNAALTVPALTEKDAADLRFA
LNLGVDMVALSFVRSAVDAAAVHAIMDEVGIRVPVHAKIEKPQAVAELDEIIEAFDGLMI
ARGDLGVELPLEDVPLVQKRAVSQARERAKPVIVATQVLESMVSAPRPTRAEASDCANAV
LDGADAIMLSAETSVGAYPIEATATMARIIETAEADLGRIPPLRTEPRTLGGALAQAAAS
VGAAVGARYLVAHTLSGDTARRLARYRTEVPVLAFTPIPAVRNQMALFWGVETFLVPFAD
STDEMVRQVDSALFHIGRCKPGELVVVVAGTPPGVAGMTNMMRVHRIGEAI
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgccccgtagagccaagattgtttgtaccctcggccccgcgaccagctcgccagagaag
gtccgggccctcgtcgacgcgggaatggacattgcccgactaaacttctcccacggaaca
cacgaacagcatgccgtcacttacgcgcgggtgcgcgaggccgcggaggcggccggccgc
agcgtcggcacgctcgccgacctccagggaccgaaaatccggctggggaacttcgccgac
ggcggggtcaccctgctgcccggtcagcggttcaccgtcacgatccgcgatgttcccggc
gatcagcatcaggtcggcacgacctacccgggcctgccgggcgacgtcgcggccggggat
cgcgtcctggtcgacgacggccgcctggtcctgcagatcgacggggtgactgacaccgac
gtccacaccacggtcgttgtcggcgggccggtgagcgaccacaaggggatgaacattccc
aacgccgcgctcaccgtcccggcgctcaccgagaaggacgccgctgacctgcggttcgct
ctcaacctcggggtggacatggtcgcactgtccttcgtccggagcgccgtggacgccgcg
gcggtgcatgcgatcatggatgaggtggggatccgggttccggtccacgccaagatcgag
aagccgcaggcggtcgccgaactcgacgagatcatcgaggcgttcgacggtctgatgatc
gcccgtggcgatctcggggtcgagctgccgctcgaggacgtgccgctcgtgcagaagcgc
gccgtcagccaggcccgggagcgggccaagccggtgatcgtcgcgacccaggtgctcgag
tccatggtcagcgcgccgcggccgacccgtgccgaggccagtgactgcgccaacgccgtc
ctggacggcgctgacgcgatcatgctgtcggcggagacgagcgtcggtgcctaccccatc
gaggccacggccaccatggcgcgcatcatcgagaccgccgaggccgacctcggccggata
ccgcccctgcggaccgaaccgcgcacgctcggtggggcactcgcccaggccgccgcgtcg
gtaggagccgcggtcggcgcccgttacctcgtggcccacaccctcagtggtgacacggcc
cggcgactcgcccggtaccgtaccgaggtcccggtgctggccttcacgccgattccggct
gtccgcaaccagatggcgctcttctggggcgtggaaaccttcctcgtgccgttcgcggac
agcacggacgagatggtccgccaggtcgacagcgccctcttccatattggccgatgcaag
ccgggtgaactggtggtcgtcgtcgccgggacgccgccgggcgtggccggcatgaccaac
atgatgcgggtccatcgcatcggggaggccatctga

DBGET integrated database retrieval system