KEGG   Frankia sp. CcI3: Francci3_1929Help
Entry
Francci3_1929     CDS       T00320                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
fra  Frankia sp. CcI3
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(2266390..2268336)
Genome map
AA seq 648 aa AA seqDB search
MPAIRSEVTSPTSAISPMSPTLHPRPGPPRSATTGGPTHATHGSHPTDPTGTTDARGHHE
PLDAETLHDALDVAAARHPDTPVTFPSTHEVISLRDLAATSRIIAAALTTDGVQAGERVG
VLAANSAEFLLALFAISRAGAAACPLPLPTTAHDLNGYADRVSRTTAAAGIHRVVTGGRV
SAILRRTADRLGGLRFLPAADLVRDVGPATPTRQPHPGPECPVGAVGAVGADDVAIVQFT
SGSTAAPKGVVLSHRAVLCGIRAIIDGIRLGEGDHGGIWLPLFHDMGLFATLSAIMTGIP
MTVWSPADFVRDPAGWLRSFLASGATISPAPNFAYDDLVRAIDPDEVPGLDMRRWRVALN
GAEPVSAVGVERFLDHFAPAGFAPTAMFPVYGMAEATLAVAFPPLGRAPVVTWVDRDRLA
AEGIVTEVPREHPRAKGLVAVGRPVRDIRIRIADLHGDVLADPLGDGLAPSLRVGEIQIR
GGSVTSGYLTAGGLTTGGFTADGWLRTGDLGFQRGDDLFVTGRDKEMIIIRGVNYYPEDA
EAAVRDLPGVHRRRVVAFGSPDQPDAAGSPPDATGAKAAGGVTVVGETALTEPADRARLA
TDLRMAATAALGLSTVTVRLVEPGALPRTSSGKFQRLAVRDLVGRGVL
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccatccggagcgaggtcacctcgcccacctccgccatctcgcccatgtctccg
actctccatccgcggccgggccccccacggtcggcgacgaccggcgggccgacccacgcg
acccacggcagccacccgaccgacccgaccggcacgaccgacgctcgcgggcaccatgag
ccgctcgacgccgagacgttgcacgacgcactggacgtcgcggccgcccggcatcccgac
acgcccgtcacgttcccgtccacccacgaggtgatctcgctgcgggacctcgcggccacc
tcccggatcatcgcggccgcgctgacgacggacggggtccaggccggcgagcgggttggg
gtgctggccgcgaactcggccgagtttctgctcgcgctcttcgcgatcagtcgggcgggc
gcggcggcctgtccgctgccactgccgaccaccgcgcacgacctcaacggctatgccgac
cgggtctcgcgcactacggcggccgcgggcatccaccgggtggtcaccggcggccgagtg
tcggccatcctgcgccgcacggccgaccggctcggcggactccggttcctccccgcggct
gacctggtccgcgacgtcggtcccgccacgcccacacgccagccacatccgggtcccgaa
tgcccggtgggtgcggtgggtgcggtgggtgcggacgacgtcgcgatcgtgcagttcacc
tccggcagcaccgcggccccgaagggcgtggtgctcagccaccgcgccgtgctgtgcggc
atccgcgcgatcatcgacggcatccggctcggtgaaggcgatcacggcggaatctggttg
ccgctgttccacgacatggggctgttcgcgaccctcagcgcgatcatgaccggcatcccg
atgaccgtctggtccccggcggacttcgtccgtgaccccgccggctggctgcgctcgttc
ctcgccagcggcgccacgatctcgccggcgccgaacttcgcctacgacgacctcgtccgg
gcgatcgacccagacgaggtacccgggctggacatgcgccggtggcgcgtcgcgctgaac
ggagccgagccggtctccgcggtcggcgtcgagcgcttcctcgaccacttcgcgccggcc
gggttcgcccccacggcgatgttccccgtgtacgggatggccgaggccaccctggccgtg
gccttcccgccgctgggccgcgcccccgtggtcacctgggtcgaccgggaccgactcgcc
gccgagggaatcgtgacggaggtcccgcgcgagcatccgcgcgccaaggggctggtcgcc
gtcggccggccggtccgcgacatccggattcgcatcgccgacctgcacggtgacgtcctg
gccgatccgctcggcgacggtctggcgccgagcctgcgggtgggcgagatccagatccgg
ggtggttcggtcacctcgggctacctcaccgcggggggcctgacgaccgggggcttcaca
gcggacggctggctgcgcaccggcgacctcggcttccagcgcggcgacgatctgttcgtg
accggccgggacaaggaaatgatcattatacgcggcgtgaactactaccccgaggacgcc
gaagcggcggtgcgtgaccttccgggcgtgcaccgacgtcgcgtcgtcgccttcggctcc
cccgaccagccggacgccgccggcagccctccggacgccaccggagcgaaggctgccggc
ggcgtcacggtggtcggcgagaccgcgctgaccgagcccgcggaccgagcccgactcgcg
accgacctgcggatggcggcgactgcggcgctggggctgtccacggtgacggtgcgtctg
gtcgagcccggcgcgctgccccgcacctccagcggcaaattccaacggctggcggtacgc
gacctggtcgggcgcggcgtgctctga

DBGET integrated database retrieval system