KEGG   Frankia sp. EAN1pec: Franean1_3965Help
Entry
Franean1_3965     CDS       T00608                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
fre  Frankia sp. EAN1pec
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
4747678..4749519
Genome map
AA seq 613 aa AA seqDB search
MHDAPAEVAIPAPRAVPVSSPVDLVPADLVPADSVAAGSTAAAALAAGTLHAGLATVAAR
HPGLPLDFPSAGASLTLGELVARADVLAAALTGAGVVARDRVGVLSDNAPDFLVALAGVS
RAGAAACPLPLPASTRDLPGYAARLARAVAVADIRLVLVGGRTARMADRFAGAFDGVRLV
RVADLTTPAAAGTVPATGTAPAAAGGAAPAGPAVEVSPDEAALVQFTSGSTAAPKGVVLT
HRNILAGLAAIIGGVALTEVDHGGIWLPLFHDMGLFGTLAGIFTGMPMTVWSPAAFVKDP
AGWLTDFLGRGGSIAPMPNFAYDHLAEAVPAPREAGLDLSGWRVAFNGAEPVEPASVERF
LTTFTPAGFAPAAMMPVYGMAEATLAVTFPPPGRAPVHRWVDRDLLARDGVARDVPAGSP
SARGLAGVGRPVRAMRVRIGGRDGTGVLGDDQVGEIQISGDAVTGGYLTDTGAQPSGAFT
ADGWLRTGDLGLLRDGELFVTGRDKEMVIVRGVNYYPHDAEEAARDVPGVHRRRCVAYAD
RSPGGAETMAVLAETRLVDDTERAALAAAIRVAVTAALGLAEIAVALVGPDALPRTSSGK
FQRLAAREACVPT
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgctccggccgaggtggcgatcccggcgccccgcgccgtccccgtttcctca
cccgtcgatctcgtacctgccgatctcgtacctgccgattccgtggccgccggctcgacg
gccgccgccgcgctcgcggcgggcaccctgcacgccggcctggccacggtggcggcccgc
catccggggttgcctctcgacttcccctccgccggagcgtcgctgacgctgggcgagctc
gtcgcccgcgcggacgtcctggcggcagccctgaccggtgccggggtcgtcgcccgtgac
cgggtcggagtgctcagcgacaacgcgcccgactttctggtggccctggccggagtgagc
cgggcgggagccgccgcgtgccccctgccgctgcccgcctccacccgtgacctgcccggc
tacgccgcgcggctggcgcgcgcggtcgccgtcgccgacatccggctcgtgctggtcggc
ggccggacggcccggatggccgaccgcttcgccggggccttcgacggcgtccgcctcgtc
cgggtcgccgacctcaccacaccggccgccgccggcactgtcccggccaccggcaccgcg
ccagccgccgctggcggtgcggccccggccggcccggcggtggaggtgtcacccgacgag
gccgccctggtccagttcacctccggtagcaccgccgccccgaagggcgtcgtactgacg
caccgcaacatcctggccgggctggccgcgatcatcggcggcgtcgcgctgaccgaggtc
gaccacggcggcatctggctgccgctcttccacgacatgggcctgttcggcacgctcgcc
ggcatcttcaccggcatgccgatgaccgtctggtcaccggccgccttcgtgaaggacccg
gccggctggctgacagacttcctcggccgcggcggcagcatcgcccccatgccgaacttc
gcctacgaccacctggcggaggccgtccccgcgccgcgggaggccggcctggacctgagc
ggctggcgggtcgccttcaacggcgccgagccggtcgagcccgcctcggtcgagcgcttc
ctcaccaccttcaccccggccggcttcgcgccggcggcgatgatgcccgtctacgggatg
gccgaggccacgctggcggtgaccttcccgccaccgggccgcgcccccgtgcaccgctgg
gtcgaccgcgacctgctcgcccgcgacggcgtcgcgcgcgacgtgcccgccggctcgccg
tccgcccgcgggctggccggggtggggcgaccggtgcgcgccatgcgggtgcggatcggc
ggccgcgacggcaccggcgtgctcggtgacgaccaggtcggcgagatccagatcagcggc
gacgcggtgacgggcggctacctgaccgacaccggcgcgcagccgtccggcgcgttcacc
gcggacggctggctgcgcaccggcgaccttggcctgctgcgcgacggcgagctcttcgtc
accggccgggacaaggagatggtgatcgtccgcggggtgaactactacccccacgacgcc
gaggaggccgcccgggacgtccccggcgtccaccgccgccgctgcgtcgcctacgcggac
cgctcacccgggggcgccgagacgatggcagtcctcgccgagacccggctggtcgacgac
accgagcgcgcggcgctggccgccgcgatccgggtggcggtgaccgccgcgctggggctg
gccgagatcgccgtcgccctcgtcgggcccgatgccctgccgcggacgtccagcgggaag
ttccagcgcctcgccgcgcgcgaggcatgcgtaccgacatga

DBGET integrated database retrieval system