KEGG   Frankia sp. EAN1pec: Franean1_6908Help
Entry
Franean1_6908     CDS       T00608                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
fre  Frankia sp. EAN1pec
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
complement(8415331..8416782)
Genome map
AA seq 483 aa AA seqDB search
MQEQDRLFIGGEWVAPSGTRTIEVVSPHSEQVIARVAAPGTEDVDRAVAAARTAFDEGPW
PRLDPAERVAVIRRLGALLKPRRKELSELISAEMGAPISFAKLSHVTLPLLMMGAFADIA
ENLAWEEPRKGFYGQDILLRKEPIGVVAAIVPWNMPLFLTIGKLVPALLAGCSVVLKPSP
ETPLDAYALAESLAEAGLPQGVVSVLPGDREIGEYLVAHPGVDKVSFTGSTAAGRLVAAS
CGSNLKRVSLELGGKSAAVVLDDADPAAVAAGVEIAGLMNSGQACVAQTRILVPRARYGE
FVDALAAMVEALPVGDPSDPATKVGPLVARRQQERVRGYIEEGQKEGARLVVGGSDLPAG
VDQGWYVRPTVFADVESGMRIAQEEIFGPVLTVLPYSDDADAVRIADDTEYGLSGSVWTS
DVERGLAVARRVRSGTFGVNQAYSMDPNAPFGGVKASGIGRELGREGIESYLDVKSISVA
PAS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaacaagatcgtctgttcatcgggggcgaatgggtcgcgcccagcggcacgcgc
acgatcgaggtggtctcgccgcacagcgagcaggtcatcgctcgcgtcgccgcgcccggc
accgaggatgtggaccgggcggtggccgccgcccgtaccgcgttcgacgaggggccgtgg
ccgcgcctcgacccggccgagcgggtcgcggtcatccggcggctgggtgcgctgctcaag
ccgcggcgcaaggagctctccgagctgatcagcgccgagatgggcgcgccgatctcgttc
gccaagctgtcgcatgtgacgctgccgctgctgatgatgggcgcgttcgccgacatcgcg
gagaacctggcgtgggaggagccgcgcaagggcttctacgggcaggacattctgctgcgc
aaggagccgatcggggtcgtcgccgccatcgtcccgtggaacatgccactgttcctgacc
atcgggaagctggtgccggctctgctcgccgggtgctcggtcgtcctgaagccgtcgccg
gagacacctctcgacgcctacgcgctggccgagagcctcgccgaggccgggctgccgcag
ggcgtcgtcagcgtgctgcccggtgaccgggagatcggcgagtacctcgtggcgcacccg
ggtgtggacaaggtgtccttcaccgggtccaccgcggccggtcgcctggtggccgcgtcc
tgcgggtcgaacctcaagcgggtcagcctcgagctcggcggcaagtccgccgcggtcgtg
ctcgacgacgccgaccccgccgccgtggccgcgggcgtggagatcgccggcctgatgaac
agcgggcaggcctgcgtcgcccagacgagaatcctcgtcccgcgcgcgcggtacggcgag
ttcgtcgacgccctggccgcgatggtcgaggcactgccggtcggcgacccgtccgacccg
gcgacgaaggtcggcccgctggtcgcccgccggcagcaggagcgggtgcgcgggtacatc
gaggagggccagaaggagggcgcgcggctggtcgtcggcggcagcgacctgccggccggg
gtagaccagggctggtacgtccgcccgaccgtcttcgccgacgtcgagagcggcatgcgc
atcgcgcaggaggagatcttcggcccggtgctgaccgtgctgccctactccgacgacgcc
gacgccgtccgcatcgcggacgacaccgagtacggcctctcgggctcggtgtggacctcg
gacgtcgaacggggcctcgccgtcgcccgccgggtccgcagcgggaccttcggcgtcaac
caggcgtacagcatggacccgaacgcgccgttcggtggggtcaaggccagcgggatcggc
cgtgagctgggtcgcgagggcatcgagagctacctcgacgtgaagtcgatctcggtggcg
ccggcctcctga

DBGET integrated database retrieval system