KEGG   Frankia sp. EuI1c: FraEuI1c_0751Help
Entry
FraEuI1c_0751     CDS       T01354                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
fri  Frankia sp. EuI1c
Pathway
fri03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fri00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    FraEuI1c_0751
Enzymes [BR:fri01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FraEuI1c_0751
DNA repair and recombination proteins [BR:fri03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     FraEuI1c_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADP78829
UniProt: E3IUU9
LinkDB All DBs
Position
complement(938634..939674)
Genome map
AA seq 346 aa AA seqDB search
MGEASRASGPGPSDKSARGTKDESASDPKGAGGTATAGGGAATAGGGAAKKSAAGAVEVD
GRRLKVTNLDKVLYPEAGTTKAEVIHYYTEIASVLLPHLTDRPLTVVRFPEGVGAAGFFS
KNAPSHRPEWVRTATLPSPGSSKNRGTIDYLVAEERPTLVWLANLAAIEMHTPMWRVSTR
LPDLVVADLDPGPGTTVLDCARVALLLRDVLPEPLCVKTSGSKGLQVYGRVDDGRESMKV
RDEMHVVAEKLARDHPDLVVSNMRKDLRPGRVLLDWSQNNPAKTTVSVYSLRARAAPTVS
TPVTWDEVAAAREPADLVFTATQVLDRVAAHGDLFTPLLGPLSAAP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggcaagccgcgcgagcggaccgggaccaagcgacaagtccgcacgcgggacc
aaggacgagtccgcgagcgaccccaagggagccggcggcaccgcgacggccggcgggggc
gcggcgactgccggcgggggtgcggctaagaagtccgcggcgggagccgtcgaggtggac
gggcgccggctcaaggtcaccaacctcgacaaggtgctctacccggaggccggcaccacc
aaggccgaggtgatccactactacaccgagatcgcctcggtcctgctgccgcacctgacc
gaccgtcccctgaccgtcgtccgcttccccgagggagtcggcgccgcgggcttcttcagc
aagaacgccccgtcacaccgtccggagtgggtgcgcaccgcgacgctgccgtcccccggc
tccagcaagaaccggggaacgatcgactacctggtcgccgaggaacgcccgacgctggtc
tggctggcgaatctggccgcgatcgagatgcacaccccgatgtggcgggtctccacccgg
ctaccggacctcgtggtcgccgacctcgaccccggcccggggacgaccgtgctggactgc
gcccgggtcgcgctgctgctgcgcgacgtcctgcccgagccgctgtgcgtcaagaccagc
ggctcgaaggggctccaggtctacggcagggtcgacgacgggcgcgagagcatgaaggtg
cgcgacgagatgcacgtcgtcgccgagaagctggcccgggaccacccggacctcgtcgtg
tccaacatgcgcaaggacctgcgcccagggcgggtgctgctggactggtcgcagaacaac
ccggcgaagacgacggtctccgtgtactcgctgcgggcccgggcggcgccgaccgtctcg
acgccggtcacctgggacgaggtcgccgcggcgcgcgagcccgcggacctcgtcttcacc
gcgacccaggtgctcgaccgggtcgccgcccacggcgaccttttcaccccgctgctcggg
ccgctgtcggcggcgccctga

DBGET integrated database retrieval system