KEGG   Frankia sp. EuI1c: FraEuI1c_2627Help
Entry
FraEuI1c_2627     CDS       T01354                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3207311..3208999
Genome map
AA seq 562 aa AA seqDB search
MLTGSAGNLTDALAAVVAADPTCPVSFPSTGRDLTVRELATLSQAVAGALAGRGVEGGER
LGVLSRNSPDFLVALFAAVRVGAAACPLPLPTSARDLSGYASRLSGIVAAAGIRRILVDD
KLGGVASRLAGVLAGVELIPLGSLTAEGSGAAGAPRLPDVEPDELAVVQFTSGSTAAPKG
VRLTHRNVLAGLAAIAEGIDIRPGEDHGALWLPMFHDMGLFGTLAGMFAGIPMTVWNPGA
FVKDPARWLREFAARGGTISPAPSFGYETLVEAVPRDEVPKLDLSRWRVALNGAEPIPMA
GIESFLEHFAPAGLAPTVMLPVYGMAEATLAVTFPPLGRVPTALWVDRDRLASDGRAVFV
AADDQRARGLPALGGPVRGVRVRVVGADGRPVADREIGEVEIAGEPVTAGYLTAPGAPPA
PVPDADGWLGTGDLGFQHEGELYVTGRRKEMIIVRGVNFYPEDAESVIRDAPGLHRRRCV
AFADTGDGGGELITIVGESALEDPADRARLAADLRAAVSGALGLPDVAVHLVGPDDLPRT
SSGKFQRLAARELTREAARLDA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccggtagcgccggcaacctcaccgacgccctggcggcggtcgtcgccgccgat
cccacctgcccggtgtcctttccctccaccggccgggacctcaccgtccgcgagctcgcc
acgctctcccaggccgtggccggcgcgctggccgggcgcggggtcgagggcggtgagcgg
ctcggggtgctcagccgcaacagcccggacttcctcgtcgcgctgttcgccgccgtgcgg
gtgggcgccgccgcctgcccgctgccgctgccgacctcggcccgcgacctgtccggctac
gccagccggctgtccgggatcgtcgcggccgccggcatccggcgcatcctcgtcgacgac
aagctcggcggggtcgccagtcggctcgcgggggtgctcgccggggtggagctgatcccg
ctgggcagtctcaccgccgagggcagcggcgccgccggcgcgccgcggctgcccgacgtc
gaaccggacgagctcgcggtcgtccagttcacctcgggcagcacggcggcgccgaagggg
gtgcggctgacccaccgcaacgtcctcgccgggctcgccgcgatcgccgagggcatcgac
atccgcccgggcgaggaccacggcgccctgtggctgccgatgttccacgacatgggcctg
ttcgggaccctggccggcatgttcgccgggatcccgatgacggtctggaaccccggcgcg
ttcgtgaaggacccggcccgctggctgcgcgagttcgccgcccgcggcgggacgatctcg
ccggccccgagcttcgggtacgagacgctggtcgaggccgtgccgcgcgacgaggtcccc
aagctcgacctcagccgctggcgggtcgcgctgaacggggccgagccgatcccgatggcc
ggcatcgagagcttcctggagcacttcgcgccggccggcctcgcgccgacggtgatgctg
ccggtctacgggatggccgaggcgacgctcgcggtcaccttcccgccgctgggccgggtc
ccgaccgcgctgtgggtggaccgggaccggctggcctcggacggccgggcggtctttgtc
gcggcggacgaccagcgggctcgggggctgcccgcgctcggtggtccggtccgcggggtc
cgggtccgggtggtcggcgcggatgggcggccggtcgcggaccgcgagatcggcgaggtc
gagatcgccggcgagccggtcaccgccggctacctcaccgcgccgggtgcgccccccgcg
cccgtgcccgacgccgacggctggctcggcaccggcgacctcgggttccagcacgagggg
gagctgtacgtgaccggccggcgcaaggaaatgatcatcgtgcgcggcgtgaacttctac
ccggaggacgccgagagcgtgatccgggacgcgcccggcctgcaccggcggcgctgcgtc
gcgttcgccgacaccggcgacggcggcggcgagctgatcaccatcgtcggcgagagcgcg
ctggaggacccggccgaccgggcccggctcgccgccgacctgcgggccgccgtgtcgggc
gcgctcggcctgccggacgtggccgtgcacctcgtcggccccgacgacctgccccgcacc
tccagcgggaagttccagcggctcgccgcccgggagctgacccgggaggcggcccgcctg
gacgcctga

DBGET integrated database retrieval system