KEGG   Francisella sp. MA067296: BBG19_0704Help
Entry
BBG19_0704        CDS       T05204                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
frm  Francisella sp. MA067296
Pathway
frm00240  Pyrimidine metabolism
frm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BBG19_0704
Enzymes [BR:frm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BBG19_0704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK FAD_binding_4 AAA_22 DUF4280 AAA_30
Motif
Other DBs
NCBI-ProteinID: APC91440
UniProt: A0A1J0KAS2
LinkDB All DBs
Position
727301..727864
Genome map
AA seq 187 aa AA seqDB search
MDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRAGLNKVKSRIGIDQDAYSLTDRDNIFE
FVKNYNCRDKVDCVLIDEIHFFTQQQIWHLADIVDELNIPVICYGLRTNYLGQPFETAAL
LLAIADTLEEVKTICHCGKKASFNMMVQNGKAIKQGNPIVVDDDSLKEVDTKYVSVCRKH
WKDGVYE
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggatgctggtaagacactagatcttttaaaagttgcctataattatgaagatagaggt
agaaagcctctagttttgacatcagcgattgataaaagagcgggtttgaataaggtcaaa
tcacgcataggtatagatcaagatgcttactcactgactgacagagacaacatctttgaa
tttgtcaaaaattataattgtagagataaggtagattgtgttttgatagatgaaattcat
tttttcactcaacaacagatttggcatctggctgatatagtcgatgaactaaatatcccg
gtgatttgttatggtctacgcacgaattatttgggacagccatttgagacagcagcacta
cttttggctattgcagatactcttgaagaggtcaaaacaatttgtcattgcggtaaaaag
gcaagttttaacatgatggtgcagaatggtaaagcgataaaacaaggtaatcctatagtg
gttgatgatgattcacttaaagaggtagataccaaatatgtctctgtatgtcgtaagcat
tggaaagatggtgtgtatgaataa

DBGET integrated database retrieval system