KEGG   Fibrobacter succinogenes: Fisuc_0993Help
Entry
Fisuc_0993        CDS       T01099                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
fsu  Fibrobacter succinogenes
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Fisuc_0993
Enzymes [BR:fsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Fisuc_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1222711..1224021)
Genome map
AA seq 436 aa AA seqDB search
MAKTVYLGMIGDIMHPGLINIINEGAKYGDVMIGLFTDKAIATHKRLPYLNYEQRKNVIE
NIKGVSKIVPQDEWSYVENLKRYKPDYIIHGDDWLYGPDKYIRDEVFKVMESLGGKVIEI
PYTKGITSAGLKKEMDSLGTTPQARLSSLRRLIAAKPIVRILESHNGLTGLIAEHTSVEI
NGCVREFDGMWSSSLTDSTSKGKPDIEAVDLTTRLHDLNDTLEVTTKPVIFDGDTGGKVE
HFGFTVRTLERLGISAVIIEDKVGLKQNSLFGTDAIQSQDTIEGFCTKIRAGKEAQITDD
FMVISRCESLIAGKSVDDALERCHAYVAAGTDGIMIHSKDKSGEDIKEFCKRFREKDAHT
PIVAVPTTYNQFTEEELSTWGINIVIYANHMLRSAYPAMVKCAESILTHSRSLEASNDYC
MPIKQILNLIPGTMKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacagtatatctaggaatgattggtgacatcatgcacccgggccttatcaac
atcatcaatgaaggcgcaaagtacggtgatgtgatgattggactttttacggataaggcg
attgcaacgcacaagcgccttccgtatctgaattacgagcagcgcaagaacgtcatcgag
aacatcaagggcgtatcaaagattgttccccaggatgaatggagttatgttgaaaacttg
aagaggtacaagccggactatatcattcatggtgatgactggctttacggcccggacaag
tatatccgtgacgaggtgttcaaggttatggaatccttaggtggcaaggttattgaaatc
ccttacaccaagggcattacttctgctggcctcaaaaaggaaatggatagcctcggtacg
acaccacaggcgagactttcttcactgcgccgcctgattgcggccaagccgattgttcgt
attttggaatctcataatggccttacgggcttgattgctgaacatacgagtgttgaaatc
aacggctgcgttcgcgagtttgacggtatgtggtcttcttcgctcaccgattccacgagt
aaggggaagccggatatcgaggctgtggaccttacgactcgtctgcatgacttgaatgat
acgctcgaagtcacgacaaagccggttatctttgatggcgatacgggtggaaaggtcgaa
cattttggctttactgtgcgcacgctcgaacgccttggcatttctgcggtcatcattgaa
gacaaggttggcctcaaacagaactctctgtttggtacagatgctattcaatcgcaggat
acgattgaaggtttctgcacaaaaatacgtgcgggcaaggaagcccagattacggacgac
ttcatggtgatctcccgctgcgaatcgctcattgcgggcaagtccgtggacgatgccttg
gaacgttgccatgcctacgtggccgccggtactgatggcatcatgatccattccaaggac
aaaagcggcgaagacatcaaggaattctgcaagcgtttccgcgagaaggacgctcatacg
ccgattgttgcagtacccacgacctacaaccagtttactgaagaggaactttcgacttgg
ggtatcaacattgtcatctatgcaaaccacatgcttaggtctgcatacccggcgatggtg
aagtgtgcggagtccatccttacgcacagccgtagcctcgaagcttcaaacgactactgc
atgcctatcaagcagattttgaaccttattcccggaacgatgaagaagtaa

DBGET integrated database retrieval system