KEGG   Francisella tularensis TIGB03: FTU_1390Help
Entry
FTU_1390          CDS       T01762                                 

Gene name
pyk
Definition
Pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
ftg  Francisella tularensis TIGB03
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ftg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    FTU_1390 (pyk)
   01230 Biosynthesis of amino acids
    FTU_1390 (pyk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTU_1390 (pyk)
   00620 Pyruvate metabolism
    FTU_1390 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    FTU_1390 (pyk)
Enzymes [BR:ftg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     FTU_1390 (pyk)
Exosome [BR:ftg04147]
 Exosomal proteins
  Proteins found in most exosomes
   FTU_1390 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
LinkDB All DBs
Position
complement(1487090..1488526)
Genome map
AA seq 478 aa AA seqDB search
MRRTKILATLGPASESREALTEMIKAGVNAVRCNFSHGSAEDHRKRVDLIRQIAKEQDTH
VGILADLQGPKIRLSKFKNGSVEIKKGQKFTLDADLGINDGDENTVGIDYKELIQDVKKG
DILLVDDGKIVLEVDSVKGNKAVTKVVVGGKVSNNKGINKKGGGLTAPALTEKDKEDIKI
AAMLQVDFLAVSFVRDGKDMEYARQLVHEAGWRPAMVAKIERAEAVLEDNLKSIVDASDL
VMVARGDLAVEIGDENVPTVQKLIISTARRNEKGSITATQMMESMIENSSPTRAEASDVA
NAVFDGTDAVMLSAETAVGKYPVETVSAMSRICKSAEKSKYTHISKKQKIADCDRIDHAV
SVAAVKIANDIGAKGLIVLTEGGNTSRWMSRINTDLPIYALSRNATTLGAMTLFRGVVPI
YFDSTRMSKLYVNRSACMELESRNLAKDGDIFVLTSGDSMGVHGSTNKIKVIIAGQVR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagaagaacaaaaattttagctactcttggtcctgctagtgaatcaagagaagctcta
acagagatgattaaagcaggggttaatgcagttagatgtaatttttcgcatggctctgct
gaagatcatcgcaaaagagttgatttaattcgtcaaatcgcaaaagagcaagatacacat
gttggtattttagctgatttacagggaccaaaaatcagattatcaaaatttaaaaatggt
tccgtagaaattaagaaaggtcaaaaatttacactggatgctgatcttggtattaatgat
ggtgatgagaatactgtagggattgactataaagaactcattcaagatgtaaaaaaaggc
gatatactacttgtagatgatggcaaaattgtcttagaggttgattctgtaaaaggaaat
aaggcagtcactaaagttgtcgttggcggtaaagtttctaataataaaggcatcaataag
aaaggtggcggacttacagcacctgcacttactgagaaagacaaagaagatataaaaata
gctgcgatgctacaagtggatttcttagcggtatcatttgtcagagatggtaaggatatg
gagtatgcacgtcaacttgtccacgaagccggttggagacctgctatggtggctaaaatt
gagcgtgcagaggctgtcttggaagataaccttaagagtattgttgatgcttctgacctt
gtaatggtagcgcgtggtgatttggctgttgaaattggtgatgagaatgtgccaactgta
cagaagcttattatcagtacagctagacgaaatgaaaaaggttctattactgctacacaa
atgatggagtcgatgatagagaactcttcaccaactcgtgctgaagcatctgatgttgct
aatgctgtttttgatggcacagatgctgtaatgttatcagctgaaacagcggtaggtaaa
tatcctgttgaaacagtttctgcaatgtcaaggatatgtaaatctgctgaaaaaagtaag
tatacacatatttctaaaaagcaaaaaatagctgattgtgataggattgatcatgctgta
tctgttgcagcagtcaaaatagctaacgatattggagctaaaggattaattgtattgaca
gagggtggtaatacttcgcgttggatgtcacgaataaatactgatttacctatttacgca
ttatcaagaaacgcaacaactttaggtgcgatgacattatttagaggtgtggtaccaata
tactttgattcaactagaatgtctaagttgtatgtaaatagatcagcttgcatggagcta
gagagcagaaatttagccaaagatggtgatatttttgtgcttactagtggcgatagtatg
ggtgtacatggaagcactaataagattaaagtgataattgcaggtcaggtaagataa

DBGET integrated database retrieval system