KEGG   Francisella tularensis subsp. tularensis TI0902: FTV_0581Help
Entry
FTV_0581          CDS       T01761                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ftt  Francisella tularensis subsp. tularensis TI0902
Pathway
ftt00240  Pyrimidine metabolism
ftt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    FTV_0581 (tdk)
Enzymes [BR:ftt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FTV_0581 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK FAD_binding_4 AAA_22 ResIII AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: AFB80297
LinkDB All DBs
Position
640142..640735
Genome map
AA seq 197 aa AA seqDB search
MAKLYFRYSAMDAGKTLDLLKVAYNYEDRGRKPLVLTSAIDKRAGLNKVKSRIGINQDAY
SLTDRDNIFEFVENYNSSNKIDCVLIDEIHFFTQEQVWQLAEIVDELNIPVICYGLRTNY
LGQPFETAALLLAIADTLEEVKTICHCGKKASCNMMVQNGKAIKQGNPIVVDDDSLKEID
TKYVSVCRKHWKEGVYE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaattatattttagatattcggctatggatgctggtaagacactagatctttta
aaagttgcttataactatgaagatagaggtaggaagcccttagtattaacatcagcgatt
gataaaagagcggggttaaataaagttaaatcacgcataggtataaatcaggatgcttac
tcactgactgatagagataatatttttgaatttgtcgaaaattataatagtagtaacaag
atagattgtgtattgatagatgaaattcatttttttactcaagagcaagtttggcaatta
gcagagatagttgatgaactaaatattcctgtgatttgctatgggttacgtactaattac
ttaggtcagccatttgagacagcagcattacttttggctattgctgatactcttgaagaa
gtcaaaacaatttgtcactgcggtaaaaaagcaagctgtaatatgatggtgcagaatggt
aaagcaataaaacaaggtaatcccatagtggttgatgatgattcgcttaaagagatagat
accaaatatgtttctgtatgtcgtaagcactggaaagaaggtgtgtatgaataa

DBGET integrated database retrieval system