KEGG   Fragaria vesca (woodland strawberry): 101291240Help
Entry
101291240         CDS       T02666                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101291240
Enzymes [BR:fve01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101291240
Transporters [BR:fve02000]
 Other Transporters
  Pores ion channels [TC:1]
   101291240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 101291240
NCBI-ProteinID: XP_004299558
LinkDB All DBs
Position
LG5
AA seq 224 aa AA seqDB search
MGEVKLLGTTQSFPCARIQWALKLKGVEYEFIEEDLGNKSSLLRKYNPVHKKVPVLVHHD
KPIAESLVILEYIDETWKDNPLLPQDPYDKAVARFWAKFADEKVLIAVWGAFTAEGEEKE
KAIKSALEPLAYLEQQIEGKKFFGGEKIGYFDLVVGWLSQWLNVMEEVGGMKLLEAERFP
LLHEWGQNFIQAPAIRECIPPREKLVEYFHFSLTYGRSLAANKP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgggagaggttaagttgcttggcacaacacaaagctttccctgcgctaggattcagtgg
gctctgaagctcaagggcgtggagtatgagttcatagaagaagatttgggaaacaagagt
tccctcctgcgcaagtataaccctgtccacaagaaggtaccagttcttgtccaccacgac
aaacccatcgccgagtcgcttgtgatccttgagtacattgatgagacatggaaggacaac
cccttgcttcctcaggacccttatgacaaagccgtagctcggttctgggctaagtttgct
gatgagaaggttctgattgcagtatggggagctttcactgccgaaggagaagagaaggag
aaggctataaagtctgcactagaaccactagcatatcttgagcagcagattgaagggaag
aaattttttggtggagaaaaaatagggtactttgatttagtagtaggttggctatcgcag
tggctcaatgtgatggaagaagttggaggcatgaagctacttgaagctgagaggttccca
cttctccatgaatggggtcagaacttcatccaagctccggcgatcagagaatgcattcca
ccgagagaaaagcttgtcgagtatttccattttagcctcacttacggacgttccttagca
gccaacaaaccatga

DBGET integrated database retrieval system