KEGG   Fragaria vesca (woodland strawberry): 101299375Help
Entry
101299375         CDS       T02666                                 

Definition
(RefSeq) beta-galactosidase 17
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
fve00052  Galactose metabolism
fve00511  Other glycan degradation
fve00531  Glycosaminoglycan degradation
fve00600  Sphingolipid metabolism
fve00604  Glycosphingolipid biosynthesis - ganglio series
fve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101299375
  Lipid metabolism
   00600 Sphingolipid metabolism
    101299375
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    101299375
   00604 Glycosphingolipid biosynthesis - ganglio series
    101299375
   00511 Other glycan degradation
    101299375
Enzymes [BR:fve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     101299375
Exosome [BR:fve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101299375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 101299375
NCBI-ProteinID: XP_011463314
LinkDB All DBs
Position
LG4
AA seq 721 aa AA seqDB search
MKYNKSLVDHHNSSSVLLSTSNWSTMARKRTTRLTLFLFLLLSLVTFGVFVPVFALLPSL
SQSQNDQQHHPTTKSNPDIVRKFEISEDRFWKDGQPFQIIGGDLHYFRILPEYWEDRLLR
AKALGLNTIQTYVPWNLHEPRAGTLNFEGIADIVSFLKLCQKLGFAVMLRPGPYICGEWD
LGGFPAWLLAIKPALTLRSSDPAFLQLVERWWGSLLPKIAPLLYGNGGPIIMVQIENEYG
SYGSDKAYLHHLVSLARKHLGEEVILYTTDGGSRETLDKGTIRGDAVFSAVDFTTGDNPW
PIFELQKEFNSPGKSPPLSSEFYTGWLTHWGEKNAQTDADFTAASLKRILERNGSAVLYM
AHGGTNFGFYNGANTGSDESDYKADLTSYDYDAPIRESGDVSNVKFKALRKAIEQYSSES
LPPVPSDIEKKGYGSIHVSKTGNLFDMIHDFDVVESEIPITMESVGQMSGFLLYVSEYNA
TEYDGGNIISIPKVHDRAQVFISCPSQDGHGKPTYVGTFERWVNQPVTLPNTKCPSKISL
YVLVENMGRLNYGPYIFDMKGILSSVYLDGRVLRGWKMYLLPLTNLNENPKVNPIIQATE
SGFITMSTRKKLKPKSAKARIEPAFYAGKFSISKQDKIKDTFVSLSGWGKGIVTINNFNI
GRYWPLKGPQCNLYVPAPILKHGENIVVIFELQAPNPELVVHLVDQPDFTCGPSKSNLHQ
L
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaagtataataagagccttgtcgatcaccataatagttcttcagtgttgttgtccacc
tccaactggtcaacaatggcgaggaagagaaccacaagactcaccttgttcttgttcctg
ctcctctccctcgtaaccttcggggtctttgtccctgtctttgctcttctgccttctctt
tcccaatctcaaaatgaccaacagcaccatccaactaccaaaagtaatccagatattgtc
agaaagtttgaaatttcagaagacaggttctggaaagatggtcagcctttccagatcatt
gggggtgacttgcattattttcggattcttcctgagtactgggaagataggctgttgaga
gcaaaggcgttgggattaaatactattcagacttatgttccctggaacctgcatgaacca
agagctggtactttgaattttgagggtattgcagatatagtatcgtttctcaaactctgc
cagaagcttgggtttgctgttatgcttcgacccggaccatatatatgtggagagtgggat
ttgggtggtttccctgcttggttacttgccatcaagcctgctctcacactaagatcatct
gacccagctttccttcaattggttgaaagatggtggggaagcttacttccaaagatagct
cctcttctctatggaaatggtggtccaatcataatggttcagattgaaaatgaatatggt
tcatatggaagtgacaaagcttatcttcatcacttggtctcattggctagaaagcacctt
ggggaagaagtaattttgtatactacagatggaggttctagggaaactctagacaaagga
acaattcgtggagatgctgtcttttctgctgttgatttcaccactggtgataatccttgg
ccaatatttgagttgcaaaaagagtttaattccccagggaaatcaccaccactttcttcg
gagttttacacaggttggcttacacactggggggagaagaatgcacaaactgacgctgat
tttacagcagcttccttaaaaagaattttggaaagaaatggttcagcagtgttgtatatg
gcacatgggggaacaaactttggattctataatggagcaaacactggttcagatgagtct
gattacaaggctgatctcacttcctatgattatgatgcgccaattagggaatctggggat
gtgagcaatgtaaaatttaaagcacttaggaaggctatagagcaatatagttcagaatct
ctacctccagttccatctgatattgaaaagaaaggatatggatctattcacgtatcaaaa
accgggaatttgtttgatatgatacatgattttgatgtggttgagtctgaaatcccaata
acaatggagtcggtaggccagatgtctggatttttgttatacgtaagtgaatataatgca
acggagtatgatggtggaaacattatatccataccaaaggtgcatgacagagctcaagtt
tttatatcatgtccttctcaagatggtcatggaaagccaacatacgttggcacatttgaa
agatgggtgaatcaaccagtgacacttcctaatactaaatgtccctccaaaatcagctta
tatgtgttggttgaaaatatgggacgtttaaattatgggccatatatctttgacatgaag
ggtattctatcttctgtttatctagatggaagagttctccgtggatggaaaatgtacttg
ttgcctctaaccaacctgaacgagaatcccaaagtcaatcccataattcaggctacagaa
tctggattcattacaatgtcaacccgtaaaaagttaaaaccaaagtctgcaaaagctcga
attgaaccagcattctatgctggaaagttttctatcagcaaacaagacaaaataaaagac
acattcgtgtcattgagtggttggggtaaaggaattgtgaccattaacaatttcaatata
ggaagatattggccgttaaaggggccacagtgcaacctctatgttcctgctcctatcctt
aagcatggggaaaacattgtggttatatttgagttacaagcgccaaaccctgagcttgtg
gtacacttggtggatcagccagacttcacctgtggtcctagtaaatcgaatctgcatcag
ttgtag

DBGET integrated database retrieval system