KEGG   Fragaria vesca (woodland strawberry): 101315253Help
Entry
101315253         CDS       T02666                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
fve  Fragaria vesca (woodland strawberry)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:fve00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    101315253
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101315253
Enzymes [BR:fve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     101315253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
LG6
AA seq 182 aa AA seqDB search
MASSMFSSSAAAVATAASPAQASMVAPFTGLKSASAFPITRKTNSDITSLPSNGGRVQCM
QVWPPVGLKKFETLSYLPPLTSESLAKEVDFLLRNKWVPCLEFELEKGFVYRENHKSPGY
YDGRYWTMWKLPMFGCTDASQVLKELEEAKKAYPNAFIRIIGFDNVRQVQCISFIAYKPA
GY
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggcctcctccatgttctcatcatcggctgccgcagtcgccaccgccgcctccccggca
caagccagcatggttgcgccattcactggcctcaagtctgcctcagctttccccatcacc
agaaagaccaacagtgatattacctcactcccaagcaatggcggaagagtgcaatgcatg
caggtgtggcctccagttggtttgaagaagttcgagacgctgtcctaccttccaccgctt
acttccgagtccttggccaaggaagttgatttccttctccgcaacaaatgggttccctgc
ttggaatttgagttggagaaaggattcgtgtaccgtgagaaccacaagtcaccgggatac
tacgacggccgctactggaccatgtggaagttgcccatgttcggatgcaccgacgcttcc
caagtgttgaaggagctcgaggaggccaagaaggcttatccaaatgctttcatccgtatc
atcggattcgacaatgtccgtcaagttcagtgcatcagtttcatcgcctacaagcctgca
ggctactaa

DBGET integrated database retrieval system