KEGG   Fusarium verticillioides: FVEG_01889Help
Entry
FVEG_01889        CDS       T04869                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fvr  Fusarium verticillioides
Pathway
fvr00010  Glycolysis / Gluconeogenesis
fvr00051  Fructose and mannose metabolism
fvr00052  Galactose metabolism
fvr00500  Starch and sucrose metabolism
fvr00520  Amino sugar and nucleotide sugar metabolism
fvr01100  Metabolic pathways
fvr01110  Biosynthesis of secondary metabolites
fvr01130  Biosynthesis of antibiotics
fvr01200  Carbon metabolism
Module
fvr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fvr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fvr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FVEG_01889
   00051 Fructose and mannose metabolism
    FVEG_01889
   00052 Galactose metabolism
    FVEG_01889
   00500 Starch and sucrose metabolism
    FVEG_01889
   00520 Amino sugar and nucleotide sugar metabolism
    FVEG_01889
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FVEG_01889
Enzymes [BR:fvr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     FVEG_01889
Membrane trafficking [BR:fvr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    FVEG_01889
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 30060142
NCBI-ProteinID: XP_018744944
UniProt: W7LH61
LinkDB All DBs
Position
6
AA seq 681 aa AA seqDB search
MEAQQVQVYGHGHGHEIKTKKRPWPRFLVSCVALMLILVQLSQLVLSNGDAKLQQQPELK
FPRNLLTSLSSANASILVSFSSLLQLFFLQTLRLLFPQLSFSSPLPIPSASEAVCSITPL
FTTTPPTSPAITMALADESNRIVKEFDFSDEELNNHVKEFLRQMDEGLHKEGTSLQQIPT
YVTGVPNGTEKGLYLAVDLGGTNFRVCSIMLNGDTTFNLTYNKVAIPKELMVAKTSAQLF
SFLAKQIEIFLKEHHADHFNSHLRRRNTASTPSGYRHEHIFRLGFTFSFPVKQLAINKGL
LIRWTKGFDIPDAIGKDVCALLQTEIDKLHLPVKVAALVNDTVGTLMARSYTSTSKSRSV
LGAIFGTGTNGAYMEKLSNIKKPISGEYDQSTGEMVVNTEWGSFDNQLNVLPSTPWDKAL
DAESVNPGLQMFEKRVSGMFLGEIVRLAMADMINNESSSLFKDLNSSTNDWGTTTNIAPS
SGFLKPWGLDSSIMSVAAADNTPELSTLRQELENLLSVYTPSLEDAQAFKSVSNAVGRRA
ARLSAVAIGAIALNSGKLNDLDEEVIDIGVDGSLVEHYPFFRDMIYEALRAIDGIGPQGA
EKIRIGIAKDGSGVGAALIALVAAGREKPEDYLTDLRSESNRARKSSDAILDSAPVSNQA
LLIGGAVGLLALAAIWYNKRR
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggaggcacagcaggtgcaggtgtatggacatggacatggacatgagattaagacgaag
aagcgcccttggcctcggttccttgtctcatgtgtagctctcatgctgattctagtgcag
ctctcccagcttgtcctcagtaacggtgacgccaagctccagcagcagccagagctcaaa
ttcccaagaaaccttttgacctcgttgtcgtccgccaacgcctcaattctggtttccttc
tcctctctcctccaattattttttctacaaactcttcgccttttattccctcaactctct
ttctcatccccactaccaatcccttcagcgtccgaagctgtctgctctatcacccctctc
ttcacgacaacgccgcctacctcaccagctatcaccatggctctcgctgacgagtccaac
cgtatcgtcaaagagttcgacttctccgacgaggaactgaacaatcatgtgaaggagttc
ttgaggcaaatggacgagggccttcacaaagagggtaccagcctccaacaaattcctacc
tacgtcactggcgttcccaatggcacagaaaagggtctgtatctggccgttgatctggga
ggcacaaacttccgagtttgctccatcatgctcaatggtgacaccacctttaacctcact
tacaacaaggttgccattccgaaggagcttatggtcgcaaagacctctgcacagctcttt
tctttcctcgccaagcagatcgagatcttcctcaaggagcaccacgccgaccacttcaac
tcccacctgcgccgtcgcaacactgccagtacaccatcgggctatcgccatgaacatatt
ttccgccttggtttcaccttcagcttccctgtcaagcagctagccattaacaagggtctg
ctaatccgatggaccaagggctttgacattcctgatgccataggcaaggacgtctgcgct
ctgcttcagaccgagatcgacaagctccatcttcccgtcaaggttgcggcgctcgtaaac
gacactgtcggcactctcatggctcgatcctacacttcaaccagcaagagccgatctgtt
ctcggtgccatctttggtactggtaccaatggtgcctacatggaaaaattgagcaacatc
aagaagcctatctctggggagtacgatcaatcaacaggagagatggttgtcaacacagag
tggggttcttttgacaaccagctcaatgtcttgccatcaacaccttgggacaaggctctt
gacgccgaaagcgtaaaccctggccttcaaatgttcgagaagcgggtatctggtatgttc
ttgggcgagattgtccgacttgccatggccgatatgatcaacaatgagagctcgtctctg
ttcaaggatctcaactcgagcacgaacgactggggcactaccacaaacatcgcgccatcg
tctggtttccttaagccttggggactcgacagctccatcatgtccgttgcggccgccgac
aatacacctgagctgtctacccttcgccaagaactcgagaacctcctcagtgtttatact
ccctcactcgaggacgcccaggctttcaagtccgtttccaatgctgttggtcgtcgcgct
gctcgattgtcggccgtcgccattggtgccatagctctcaactctggcaagctcaatgat
ctcgatgaagaggttatcgatatcggtgtggatggcagtctcgtcgagcactaccctttc
ttccgcgatatgatctacgaggccctccgtgccattgacggcattggaccccagggtgct
gagaagatccgaatcggtatcgctaaggacggtagcggtgtcggcgccgccttgattgcc
ctggtagctgctggcagggagaagcctgaagattatttgactgacttgagatctgagtcc
aaccgcgctcgcaagtcttccgatgcgatcctcgattcagcaccagtctcgaaccaggca
ctgctcattggcggtgctgtcggtctccttgcgctagcagctatatggtacaacaagcgt
cgatga

DBGET integrated database retrieval system